DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POU3F4 and Antp

DIOPT Version :9

Sequence 1:NP_000298.3 Gene:POU3F4 / 5456 HGNCID:9217 Length:361 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:399 Identity:71/399 - (17%)
Similarity:114/399 - (28%) Gaps:185/399 - (46%)


- Green bases have known domain annotations that are detailed below.


Human    90 LGAIIHH-----------RSPHVAHHSPHTNHPNAWGASPAPN-------PSITSSG----QPLN 132
            :||.:||           .:..:.|:|.:.||.   |..|.|.       |.....|    |...
  Fly    20 MGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQ---GNMPYPRFPPYDRMPYYNGQGMDQQQQHQ 81

Human   133 VYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQF 197
            |||:|.   |...:.||:.|     .||:          :|:||... |....::.|:.::.:|.
  Fly    82 VYSRPD---SPSSQVGGVMP-----QAQT----------NGQLGVPQ-QQQQQQQQPSQNQQQQQ 127

Human   198 AKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLN--KWLEEAD 260
            |:|..|:              |......|..|.|..:.:..|......|||:..:.  ..:.|. 
  Fly   128 AQQAPQQ--------------LQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEG- 177

Human   261 SSTGSPTSIDKIAA------------QGRKRKKRTSIEVSVKGVLETH----------------- 296
               |||..:|:::.            .|..:.:....:|.|..|.|.|                 
  Fly   178 ---GSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPP 239

Human   297 ---------------------------------------------------FLKC-PKPAAQEIS 309
                                                               |.|| .:...::..
  Fly   240 VGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTY 304

Human   310 SLADSLQLEKEV------------------------VRVWFCNRRQKEKR--------------- 335
            :...:|:||||.                        :::||.|||.|.|:               
  Fly   305 TRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGD 369

Human   336 -MTPPGDQQ 343
             :|||...|
  Fly   370 EITPPNSPQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POU3F4NP_000298.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..131 10/42 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..192 10/47 (21%)
POU 186..260 CDD:197673 14/75 (19%)
Homeobox 281..335 CDD:365835 19/146 (13%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 17/148 (11%)
Homeobox 301..354 CDD:395001 11/52 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.