Sequence 1: | NP_000298.3 | Gene: | POU3F4 / 5456 | HGNCID: | 9217 | Length: | 361 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
Alignment Length: | 399 | Identity: | 71/399 - (17%) |
---|---|---|---|
Similarity: | 114/399 - (28%) | Gaps: | 185/399 - (46%) |
- Green bases have known domain annotations that are detailed below.
Human 90 LGAIIHH-----------RSPHVAHHSPHTNHPNAWGASPAPN-------PSITSSG----QPLN 132
Human 133 VYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQF 197
Human 198 AKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLN--KWLEEAD 260
Human 261 SSTGSPTSIDKIAA------------QGRKRKKRTSIEVSVKGVLETH----------------- 296
Human 297 ---------------------------------------------------FLKC-PKPAAQEIS 309
Human 310 SLADSLQLEKEV------------------------VRVWFCNRRQKEKR--------------- 335
Human 336 -MTPPGDQQ 343 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
POU3F4 | NP_000298.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 99..131 | 10/42 (24%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 144..192 | 10/47 (21%) | |||
POU | 186..260 | CDD:197673 | 14/75 (19%) | ||
Homeobox | 281..335 | CDD:365835 | 19/146 (13%) | ||
Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | 17/148 (11%) |
Homeobox | 301..354 | CDD:395001 | 11/52 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3844 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |