DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POU3F4 and pdm2

DIOPT Version :9

Sequence 1:NP_000298.3 Gene:POU3F4 / 5456 HGNCID:9217 Length:361 Species:Homo sapiens
Sequence 2:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster


Alignment Length:346 Identity:142/346 - (41%)
Similarity:173/346 - (50%) Gaps:100/346 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    25 MQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQ 89
            :|..:.|:..|::.|......:||                  :|:.||.|||....:.|      
  Fly   575 LQALAQFQALQQMKQQQREDPLPS------------------YSTPLAKSPLRSPSLSP------ 615

Human    90 LGAIIHHRSPHVAHHS-------PHTNHPNAWGASPA---PN-PSITSSGQPLNVYSQPGFTVSG 143
                       |..||       |::...|:.|.|.|   || ||:..  ||....|.|..|   
  Fly   616 -----------VPRHSKSQQRTPPNSMTANSLGMSSAVMTPNTPSMQQ--QPQLQQSTPKPT--- 664

Human   144 MLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKL 208
                .|||...|.|..                      :.|.|||...:|||||||.||||||||
  Fly   665 ----SGLTVASAMAKL----------------------EQSPEETTDLEELEQFAKTFKQRRIKL 703

Human   209 GFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSS----------- 262
            ||||.|||||:|.||||.||||||.|||||.|||||||||||||.||||:|||:           
  Fly   704 GFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNI 768

Human   263 -------TGSPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKE 320
                   :.:|.||     .||:||||||||.:|:..||..||...||.::|||.|::.|.::||
  Fly   769 NTMTSTLSSTPESI-----LGRRRKKRTSIETTVRTTLEKAFLMNCKPTSEEISQLSERLNMDKE 828

Human   321 VVRVWFCNRRQKEKRMTPPGD 341
            |:|||||||||||||:.|..|
  Fly   829 VIRVWFCNRRQKEKRINPSLD 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POU3F4NP_000298.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..131 13/42 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..192 9/47 (19%)
POU 186..260 CDD:197673 60/73 (82%)
Homeobox 281..335 CDD:365835 32/53 (60%)
pdm2NP_001285877.1 POU 691..755 CDD:197673 54/63 (86%)
Homeobox 789..842 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.