DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SDK2 and CG7607

DIOPT Version :9

Sequence 1:NP_001138424.1 Gene:SDK2 / 54549 HGNCID:19308 Length:2172 Species:Homo sapiens
Sequence 2:NP_648449.1 Gene:CG7607 / 39263 FlyBaseID:FBgn0036145 Length:167 Species:Drosophila melanogaster


Alignment Length:81 Identity:27/81 - (33%)
Similarity:36/81 - (44%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   409 LDSTVIDGMSVVLACETSGAPRPAITWQK-GERILASGSVQLPRFTPLES----GSLLISPTHIS 468
            ||.|:  |..:...|...|.|||.|||.| |..:......|:.. :.:|:    ..:.|.||...
  Fly    77 LDYTL--GRKITFFCMAQGNPRPTITWFKDGAELYQHRFFQVHE-SHIEANIVKSKMEIDPTTQM 138

Human   469 DAGTYTCLATNSRGVD 484
            |||.|.|.|.|...:|
  Fly   139 DAGFYECQADNIYAID 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SDK2NP_001138424.1 Ig 27..109 CDD:299845
IG_like 40..109 CDD:214653
I-set 120..203 CDD:254352
Ig 132..210 CDD:299845
IG_like 222..304 CDD:214653
IGc2 233..286 CDD:197706
I-set 308..397 CDD:254352
Ig 326..394 CDD:143165
I-set 402..492 CDD:254352 27/81 (33%)
Ig 416..492 CDD:299845 24/74 (32%)
Ig 502..586 CDD:299845
IG_like 502..586 CDD:214653
FN3 590..681 CDD:238020
FN3 693..786 CDD:238020
FN3 794..890 CDD:238020
FN3 895..983 CDD:238020
FN3 993..1087 CDD:238020
FN3 1099..1194 CDD:238020
FN3 1201..1290 CDD:238020
FN3 1301..1394 CDD:238020
FN3 1400..1484 CDD:238020
FN3 1503..1616 CDD:238020
FN3 1626..1719 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1707..1729
FN3 1724..1805 CDD:238020
FN3 1837..1916 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2039..2067
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2098..2172
PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 2166..2172
CG7607NP_648449.1 Ig_3 70..149 CDD:404760 25/74 (34%)
Ig strand B 85..89 CDD:409353 0/3 (0%)
Ig strand C 98..102 CDD:409353 2/3 (67%)
Ig strand E 123..132 CDD:409353 0/8 (0%)
Ig strand F 142..147 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.