DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment SDK2 and CG7607

DIOPT Version :9

Sequence 1:	NP_001138424.1	Gene:	SDK2 / 54549	HGNCID:	19308	Length:	2172	Species:	Homo sapiens
Sequence 2:	NP_648449.1	Gene:	CG7607 / 39263	FlyBaseID:	FBgn0036145	Length:	167	Species:	Drosophila melanogaster

Alignment Length:	81	Identity:	27/81 - (33%)
Similarity:	36/81 - (44%)	Gaps:	8/81 - (9%)

- Green bases have known domain annotations that are detailed below.

Human   409 LDSTVIDGMSVVLACETSGAPRPAITWQK-GERILASGSVQLPRFTPLES----GSLLISPTHIS 468
            ||.|:  |..:...|...|.|||.|||.| |..:......|:.. :.:|:    ..:.|.||...
  Fly    77 LDYTL--GRKITFFCMAQGNPRPTITWFKDGAELYQHRFFQVHE-SHIEANIVKSKMEIDPTTQM 138

Human   469 DAGTYTCLATNSRGVD 484
            |||.|.|.|.|...:|
  Fly   139 DAGFYECQADNIYAID 154

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
SDK2	NP_001138424.1	Ig	27..109	CDD:299845
		IG_like	40..109	CDD:214653
		I-set	120..203	CDD:254352
		Ig	132..210	CDD:299845
		IG_like	222..304	CDD:214653
		IGc2	233..286	CDD:197706
		I-set	308..397	CDD:254352
		Ig	326..394	CDD:143165
		I-set	402..492	CDD:254352	27/81 (33%)
		Ig	416..492	CDD:299845	24/74 (32%)
		Ig	502..586	CDD:299845
		IG_like	502..586	CDD:214653
		FN3	590..681	CDD:238020
		FN3	693..786	CDD:238020
		FN3	794..890	CDD:238020
		FN3	895..983	CDD:238020
		FN3	993..1087	CDD:238020
		FN3	1099..1194	CDD:238020
		FN3	1201..1290	CDD:238020
		FN3	1301..1394	CDD:238020
		FN3	1400..1484	CDD:238020
		FN3	1503..1616	CDD:238020
		FN3	1626..1719	CDD:238020
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1707..1729
		FN3	1724..1805	CDD:238020
		FN3	1837..1916	CDD:238020
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2039..2067
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2098..2172
		PDZ-binding. /evidence=ECO:0000250\|UniProtKB:Q6V4S5	2166..2172
CG7607	NP_648449.1	Ig_3	70..149	CDD:404760	25/74 (34%)
		Ig strand B	85..89	CDD:409353	0/3 (0%)
		Ig strand C	98..102	CDD:409353	2/3 (67%)
		Ig strand E	123..132	CDD:409353	0/8 (0%)
		Ig strand F	142..147	CDD:409353	2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910