| Sequence 1: | NP_001138424.1 | Gene: | SDK2 / 54549 | HGNCID: | 19308 | Length: | 2172 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_523713.2 | Gene: | Lac / 36363 | FlyBaseID: | FBgn0010238 | Length: | 359 | Species: | Drosophila melanogaster |
| Alignment Length: | 325 | Identity: | 86/325 - (26%) |
|---|---|---|---|
| Similarity: | 125/325 - (38%) | Gaps: | 41/325 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Human 215 PTI-IIPPKNTSVVAGTSEVTLEC-VANARPLIKLHIIWKKDGVLLSGGIS------------DH 265
Human 266 NR---RLTIPNPTGSDAGYYECEAVLRSSSVPSVVRGAYLSVLEPPQFVKEPERHITAEMEKVVD 327
Human 328 IPCQAKGVPPPSITWYKD-AAVVEVEKLTRFRQRNDGGLQISGLVPDDTGMFQCFARNAAGEVQT 391
Human 392 STYLAVTSIAPNIT--RGPLDSTVIDGMSVVLACETSGAPRPAITWQKGERILASGS-VQLPRFT 453
Human 454 PLE---SGSLLISPTHISDAGTYTCLATNSRGVDEASADL---VVWARTRITKPPQDQSVIKGTQ 512
Human 513 512 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| SDK2 | NP_001138424.1 | Ig | 27..109 | CDD:299845 | |
| IG_like | 40..109 | CDD:214653 | |||
| I-set | 120..203 | CDD:254352 | |||
| Ig | 132..210 | CDD:299845 | |||
| IG_like | 222..304 | CDD:214653 | 26/97 (27%) | ||
| IGc2 | 233..286 | CDD:197706 | 19/68 (28%) | ||
| I-set | 308..397 | CDD:254352 | 20/89 (22%) | ||
| Ig | 326..394 | CDD:143165 | 18/68 (26%) | ||
| I-set | 402..492 | CDD:254352 | 28/98 (29%) | ||
| Ig | 416..492 | CDD:299845 | 23/82 (28%) | ||
| Ig | 502..586 | CDD:299845 | 3/11 (27%) | ||
| IG_like | 502..586 | CDD:214653 | 3/11 (27%) | ||
| FN3 | 590..681 | CDD:238020 | |||
| FN3 | 693..786 | CDD:238020 | |||
| FN3 | 794..890 | CDD:238020 | |||
| FN3 | 895..983 | CDD:238020 | |||
| FN3 | 993..1087 | CDD:238020 | |||
| FN3 | 1099..1194 | CDD:238020 | |||
| FN3 | 1201..1290 | CDD:238020 | |||
| FN3 | 1301..1394 | CDD:238020 | |||
| FN3 | 1400..1484 | CDD:238020 | |||
| FN3 | 1503..1616 | CDD:238020 | |||
| FN3 | 1626..1719 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1707..1729 | ||||
| FN3 | 1724..1805 | CDD:238020 | |||
| FN3 | 1837..1916 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2039..2067 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2098..2172 | ||||
| PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 | 2166..2172 | ||||
| Lac | NP_523713.2 | IG_like | 36..131 | CDD:214653 | 26/98 (27%) |
| FR1 | 37..50 | CDD:409353 | 3/14 (21%) | ||
| Ig strand A' | 37..42 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 44..51 | CDD:409353 | 3/8 (38%) | ||
| CDR1 | 51..59 | CDD:409353 | 2/7 (29%) | ||
| Ig strand C | 59..63 | CDD:409353 | 1/3 (33%) | ||
| FR2 | 60..63 | CDD:409353 | 1/2 (50%) | ||
| CDR2 | 67..81 | CDD:409353 | 5/13 (38%) | ||
| Ig strand C' | 68..72 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C' | 79..81 | CDD:409353 | 0/1 (0%) | ||
| FR3 | 84..115 | CDD:409353 | 9/30 (30%) | ||
| Ig strand D | 84..90 | CDD:409353 | 0/5 (0%) | ||
| Ig strand E | 94..102 | CDD:409353 | 2/7 (29%) | ||
| Ig strand F | 108..115 | CDD:409353 | 4/6 (67%) | ||
| CDR3 | 116..124 | CDD:409353 | 3/9 (33%) | ||
| FR4 | 124..130 | CDD:409353 | 0/5 (0%) | ||
| Ig strand G | 124..130 | CDD:409353 | 0/5 (0%) | ||
| Ig_3 | 134..208 | CDD:404760 | 20/77 (26%) | ||
| Ig strand B | 153..157 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 166..170 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 187..191 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 201..206 | CDD:409353 | 1/4 (25%) | ||
| Ig strand G | 215..218 | CDD:409353 | 0/2 (0%) | ||
| Ig | 227..318 | CDD:416386 | 26/92 (28%) | ||
| Ig strand C | 256..260 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 286..290 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 300..305 | CDD:409353 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||