DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SDK2 and dpr2

DIOPT Version :9

Sequence 1:NP_001138424.1 Gene:SDK2 / 54549 HGNCID:19308 Length:2172 Species:Homo sapiens
Sequence 2:NP_001014480.4 Gene:dpr2 / 3346227 FlyBaseID:FBgn0261871 Length:410 Species:Drosophila melanogaster


Alignment Length:446 Identity:94/446 - (21%)
Similarity:150/446 - (33%) Gaps:124/446 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   237 CVANARPLIKLHI--IWKKDGVLLSGGISDHNRRLTIPN-PTGSDAGYYECEAVLRSSSVPSVVR 298
            |:|....:|.:.|  .|......||..|..|....::.: ..|:|       .:|...|.||.:.
  Fly    10 CIATPILVIMISISRAWTMQQQHLSPAIQQHPAVKSLSHLVDGND-------NLLPMVSAPSSID 67

Human   299 GAYLSVL---------------------EPPQFVKEP--------ERHITAEMEKVVDIPCQAKG 334
            ..|:.:.                     :||:....|        .|:||........|.|:...
  Fly    68 NDYVYIASVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITTRTGHTAAINCRVDN 132

Human   335 VPPPSITWYK-------DAAVV-----EVEKLTRFRQRNDGGLQISGLVPDDTGMFQCFARNAAG 387
            :...|::|.:       .|.::     |..|:.|.....|..|.:....|.|:|:::|.. |...
  Fly   133 LGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQV-NTEP 196

Human   388 EVQTSTYLAVTSIAPN---ITRGPLDSTVIDGMSVVLACE-----TSGAPRPAITWQKGERILA- 443
            ::..:..|.|....|:   |..||.|..|..|.||.|.|.     ||......|.|.:|..||. 
  Fly   197 KISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVKQPATSAQDIGPIYWYRGPYILTP 261

Human   444 ------SGSVQLPRFTPLES-------GSLLISPTHISDAGTYTCLATNSRGVDEASADLVVWAR 495
                  ..::.|.|.: :||       ..|.|:...:.|.|.|||:.|.:.     :|.:||   
  Fly   262 FVAHPNDAAIDLQRIS-MESTLAEKLQSRLRIANAQLLDTGNYTCMPTTAE-----AASVVV--- 317

Human   496 TRITKPPQDQS--VIKGTQASMVCGVTHDPRVTIRYI--------WEKDGATLGTES-HPRIRLD 549
                ....|:|  .::.::|....|.....|:.:...        |...|..:|:.| |.  ...
  Fly   318 ----NVINDESPAAMQKSRAIRTSGSMRSSRLVLLLAMVASSVVRWLIGGQRIGSNSCHD--SCS 376

Human   550 RNGSLHISQTWSGDIGTYTCRVISAGGNDSRSAHLRVRQLPHAPEHP-VATLSTVE 604
            ...:|||:.                       .:||.:...|..||. :...||||
  Fly   377 NLSTLHINY-----------------------CNLRAKITSHLKEHRCLGPGSTVE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SDK2NP_001138424.1 Ig 27..109 CDD:299845
IG_like 40..109 CDD:214653
I-set 120..203 CDD:254352
Ig 132..210 CDD:299845
IG_like 222..304 CDD:214653 16/69 (23%)
IGc2 233..286 CDD:197706 11/51 (22%)
I-set 308..397 CDD:254352 21/108 (19%)
Ig 326..394 CDD:143165 15/79 (19%)
I-set 402..492 CDD:254352 31/111 (28%)
Ig 416..492 CDD:299845 25/94 (27%)
Ig 502..586 CDD:299845 14/94 (15%)
IG_like 502..586 CDD:214653 14/94 (15%)
FN3 590..681 CDD:238020 7/16 (44%)
FN3 693..786 CDD:238020
FN3 794..890 CDD:238020
FN3 895..983 CDD:238020
FN3 993..1087 CDD:238020
FN3 1099..1194 CDD:238020
FN3 1201..1290 CDD:238020
FN3 1301..1394 CDD:238020
FN3 1400..1484 CDD:238020
FN3 1503..1616 CDD:238020
FN3 1626..1719 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1707..1729
FN3 1724..1805 CDD:238020
FN3 1837..1916 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2039..2067
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2098..2172
PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 2166..2172
dpr2NP_001014480.4 IG_like 113..206 CDD:214653 19/93 (20%)
Ig 116..192 CDD:299845 16/75 (21%)
ig 220..306 CDD:278476 25/86 (29%)
IG_like 220..306 CDD:214653 25/86 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.