DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POU3F2 and Antp

DIOPT Version :9

Sequence 1:NP_005595.2 Gene:POU3F2 / 5454 HGNCID:9215 Length:443 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:390 Identity:95/390 - (24%)
Similarity:131/390 - (33%) Gaps:153/390 - (39%)


- Green bases have known domain annotations that are detailed below.


Human   100 QPDIKPSV----VVQQGGRGDELHGPGALQQQHQQQQQQQQQQQQQQQQQQQQQRPPHL---VHH 157
            :|| .||.    |:.|.....:|..|...|||.||..|.|||||.||..||.||:.|.:   |.|
  Fly    85 RPD-SPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTH 148

Human   158 AANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPA---GLHHHGLRDAH 219
            .......|..:.|.        .:.|:.|||          ||:..||.|.   .:..|.:....
  Fly   149 PQQQQQQPVVYASC--------KLQAAVGGL----------GMVPEGGSPPLVDQMSGHHMNAQM 195

Human   220 DEPHHADH------------------HPHPHS-HPHQQ----PPPPPPP-------QGPP----G 250
            ..|||..|                  |.:.|: ..:||    ||...||       ||||    |
  Fly   196 TLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQG 260

Human   251 HPGAHHDPHSDEDTPTSD--------DLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTT 307
            |||.|..|..:.::.:|.        ...||.|..:::|                      .:.|
  Fly   261 HPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKR----------------------GRQT 303

Human   308 ICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAAQGRKRKKRTSIEVSVKGALESH 372
            ..|::.|:|                             :|.....|...:|..||:         
  Fly   304 YTRYQTLEL-----------------------------EKEFHFNRYLTRRRRIEI--------- 330

Human   373 FLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRD--TPPH 435
                           |.:|.|.:..:::||.|||.|.|:.....|. ||:    ||..|  |||:
  Fly   331 ---------------AHALCLTERQIKIWFQNRRMKWKKENKTKGE-PGS----GGEGDEITPPN 375

Human   436  435
              Fly   376  375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POU3F2NP_005595.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..171 29/77 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..267 26/102 (25%)
POU 262..336 CDD:197673 9/81 (11%)
Homeobox 357..411 CDD:395001 12/53 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 409..443 10/29 (34%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 39/184 (21%)
Homeobox 301..354 CDD:395001 18/105 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.