DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG46459 and Uqcc2

DIOPT Version :10

Sequence 1:NP_001369010.1 Gene:CG46459 / 54520450 FlyBaseID:FBgn0287589 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_080339.1 Gene:Uqcc2 / 67267 MGIID:1914517 Length:136 Species:Mus musculus


Alignment Length:102 Identity:37/102 - (36%)
Similarity:62/102 - (60%) Gaps:5/102 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QYQRFLKVLEKWPAEKSKVGRDLGEQIRKQVTKLTSLEGGATD----KELDRQINSLERLSNNVY 64
            :|:||||:.|:||.:::|.|||||..:|::|.: ...||..|.    :..|:...||.||.:|.|
Mouse     5 RYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQ-AFREGENTQIAEPEACDQMYESLARLHSNYY 68

  Fly    65 AKKYPRTFESTATGLTAAQCSQVLSSEFLQYLNEDSK 101
            ..||||..:::.:||:..:...:||::.|:...|.:|
Mouse    69 KHKYPRPRDTSFSGLSVEEYKLILSTDTLEEFQEMNK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG46459NP_001369010.1 UQCC2_CBP6 5..82 CDD:466331 32/80 (40%)
Uqcc2NP_080339.1 UQCC2_CBP6 6..86 CDD:466331 32/80 (40%)

Return to query results.
Submit another query.