DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG46428 and 3xHMG-box2

DIOPT Version :10

Sequence 1:NP_001369095.1 Gene:CG46428 / 54520436 FlyBaseID:FBgn0286931 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_194111.1 Gene:3xHMG-box2 / 828480 AraportID:AT4G23800 Length:456 Species:Arabidopsis thaliana


Alignment Length:63 Identity:13/63 - (20%)
Similarity:36/63 - (57%) Gaps:5/63 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRPSKFPSANPYFIFFDHFRINLQKRDICHLKPISLAKIAGRKWREMTTAQKSVFVQIAEINR 63
            ::| |.| .:.:.::.:..|..|::.   :...:.:|||.|.:|:.::..:|:.:.::|:.|:
plant   253 LKP-KHP-VSAFLVYANERRAALREE---NKSVVEVAKITGEEWKNLSDKKKAPYEKVAKKNK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG46428NP_001369095.1 HMG-box_SF 10..65 CDD:438789 10/54 (19%)
3xHMG-box2NP_194111.1 PTZ00121 <2..454 CDD:173412 13/63 (21%)
HMG-box_AtHMGB6-like_rpt1 139..206 CDD:438822
HMG-box_AtHMGB6-like_rpt2 255..320 CDD:438823 13/61 (21%)
HMG-box_AtHMGB6-like_rpt3 371..447 CDD:438824
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.