DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG46428 and Hmgb3

DIOPT Version :10

Sequence 1:NP_001369095.1 Gene:CG46428 / 54520436 FlyBaseID:FBgn0286931 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001385705.1 Gene:Hmgb3 / 305373 RGDID:1564407 Length:241 Species:Rattus norvegicus


Alignment Length:36 Identity:10/36 - (27%)
Similarity:22/36 - (61%) Gaps:3/36 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PISLA---KIAGRKWREMTTAQKSVFVQIAEINRAR 65
            |::.|   |....:|:.|::.:||.|.::|:.::.|
  Rat    76 PVNFAEFSKKCSERWKTMSSKEKSKFDEMAKADKVR 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG46428NP_001369095.1 HMG-box_SF 10..65 CDD:438789 9/34 (26%)
Hmgb3NP_001385705.1 HMG-box_HMGB_rpt1 54..117 CDD:438794 10/36 (28%)
HMG-box_HMGB_rpt2 132..202 CDD:438795
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.