DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POU2F2 and pdm2

DIOPT Version :9

Sequence 1:XP_016882373.1 Gene:POU2F2 / 5452 HGNCID:9213 Length:723 Species:Homo sapiens
Sequence 2:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster


Alignment Length:550 Identity:211/550 - (38%)
Similarity:260/550 - (47%) Gaps:135/550 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    24 LDSPSEHTDTERNGPDTNHQNPQNKT-SPFSVSPTGPSTKVGILSGLHLTF------WGPGPC-- 79
            :|.|.|.:..|:..|:..|..|.||. ...|.|||.|| .:..||....:|      .|.. |  
  Fly   419 VDPPKEPSIYEQPAPNGRHCRPANKVMRHMSNSPTPPS-PLRSLSDCGKSFEEEELELGEN-CEM 481

Human    80 -----------------------LSPPQIKAEDPSGDSAPAAPLPPQP---AQPHLPQAQLMLTG 118
                                   |:||..:..:...:...|:..||||   |...:.||..:...
  Fly   482 PQNLSSKRQARELDSELENEVLDLAPPPKRLAEEQEEEKVASVNPPQPVAFAPEEMHQALQLQLH 546

Human   119 SQLAGLTALMP--------AQQQLLLQQAQAQLLAAAVQQSSAAAAANAAAAAAAASASSSTSSS 175
            |.:..:..|.|        |.|.||....||.....|:||.......:...:.:...|.|...|.
  Fly   547 SYIEMVRQLAPEAFPNPNLATQFLLQNSLQALAQFQALQQMKQQQREDPLPSYSTPLAKSPLRSP 611

Human   176 SSSSASSSTSQPPASSGGGDLPPPQPASQPPGTPQLTLSQPIQLTAQDIQQLLQLQQLVLVPGHH 240
            |.|                  |.|:.:.....||      |..:||..    |.:...|:.|.  
  Fly   612 SLS------------------PVPRHSKSQQRTP------PNSMTANS----LGMSSAVMTPN-- 646

Human   241 LQPPAQFLLPQAQQSQPGLLPTPNLFQLPQQTQGALLTSQPRAGLPTQAVTRPTLPDPHLSHPQP 305
                                 ||::.|.||..|.   |.:|.:|| |.|.....|          
  Fly   647 ---------------------TPSMQQQPQLQQS---TPKPTSGL-TVASAMAKL---------- 676

Human   306 PKCLEPPSHPEEPSDLEELEQFARTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNL 370
                  ...|||.:|||||||||:|||||||||||||||||||||||||||||||||||||||||
  Fly   677 ------EQSPEETTDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNL 735

Human   371 SFKNMCKLKPLLEKWLNDAETMSVDS--SLPSPNQLSSP-SLGFDGLPGRRRKKRTSIETNVRFA 432
            ||||||||||||:|||.||::....|  .:.:.|.::|. |...:.:.||||||||||||.||..
  Fly   736 SFKNMCKLKPLLQKWLEDADSTVAKSGGGVFNINTMTSTLSSTPESILGRRRKKRTSIETTVRTT 800

Human   433 LEKSFLANQKPTSEEILLIAEQLHMEKEVIRVWFCNRRQKEKRINPCSAAPMLPSP-GKPAS--- 493
            |||:||.|.|||||||..::|:|:|:||||||||||||||||||||   :..|.|| |.|.|   
  Fly   801 LEKAFLMNCKPTSEEISQLSERLNMDKEVIRVWFCNRRQKEKRINP---SLDLDSPTGTPLSSHA 862

Human   494 --YSP------HMVTPQGGAGTLPLSQASS 515
              |.|      || ..:||:|:...|..||
  Fly   863 FGYPPQALNMSHM-QMEGGSGSFCGSSISS 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POU2F2XP_016882373.1 None
pdm2NP_001285877.1 POU 691..755 CDD:197673 60/63 (95%)
Homeobox 789..842 CDD:278475 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4687
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003004
OrthoInspector 1 1.000 - - mtm8655
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.