DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POU2F1 and pdm2

DIOPT Version :9

Sequence 1:XP_011507955.1 Gene:POU2F1 / 5451 HGNCID:9212 Length:769 Species:Homo sapiens
Sequence 2:NP_001285877.1 Gene:pdm2 / 34673 FlyBaseID:FBgn0004394 Length:893 Species:Drosophila melanogaster


Alignment Length:464 Identity:187/464 - (40%)
Similarity:238/464 - (51%) Gaps:91/464 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   107 SQQPSQPSQQPSVQ---AAIPQTQLMLAGGQITGLTLTPAQQQLLLQQAQAQAQLLAAAVQQHSA 168
            |..|:.||...|:.   .:..:.:|.|.........|:..:|...|........|..|...:..|
  Fly   449 SNSPTPPSPLRSLSDCGKSFEEEELELGENCEMPQNLSSKRQARELDSELENEVLDLAPPPKRLA 513

Human   169 SQQHSAAGATISASAATPMTQIPLSQPIQIA-QDLQQLQQLQQQNLNLQQFVLV--------HPT 224
            .:|.....|:::.           .||:..| :::.|..|||     |..::.:        .|.
  Fly   514 EEQEEEKVASVNP-----------PQPVAFAPEEMHQALQLQ-----LHSYIEMVRQLAPEAFPN 562

Human   225 TNLQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQS-----------QPSIT-----LTS 273
            .|| ..||::..:   .|.|.|.| .|.|:.||.:.:.|.|           .||::     ..|
  Fly   563 PNL-ATQFLLQNS---LQALAQFQ-ALQQMKQQQREDPLPSYSTPLAKSPLRSPSLSPVPRHSKS 622

Human   274 QPATPTRTIAA-------------TP-IQTLPQ-SQSTPKRID-----------TPSLEEPSDLE 312
            |..||..::.|             || :|..|| .|||||...           ..|.||.:|||
  Fly   623 QQRTPPNSMTANSLGMSSAVMTPNTPSMQQQPQLQQSTPKPTSGLTVASAMAKLEQSPEETTDLE 687

Human   313 ELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLN 377
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|||.
  Fly   688 ELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLQKWLE 752

Human   378 DAENLSSDSS------LSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEIT 436
            ||::..:.|.      .:..|.|:|.....|.|||||||||||.:|..|||:||.|.|||||||:
  Fly   753 DADSTVAKSGGGVFNINTMTSTLSSTPESILGRRRKKRTSIETTVRTTLEKAFLMNCKPTSEEIS 817

Human   437 MIADQLNMEKEVIRVWFCNRRQKEKRINP----------PSSGGTSSSPIKAIFPSPTSLVATTP 491
            .::::|||:||||||||||||||||||||          |.|......|.:|:..|...:...:.
  Fly   818 QLSERLNMDKEVIRVWFCNRRQKEKRINPSLDLDSPTGTPLSSHAFGYPPQALNMSHMQMEGGSG 882

Human   492 SLVTSSAAT 500
            |...||.::
  Fly   883 SFCGSSISS 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POU2F1XP_011507955.1 POU 306..380 CDD:197673 69/73 (95%)
Homeobox 408..461 CDD:278475 38/52 (73%)
pdm2NP_001285877.1 POU 691..755 CDD:197673 61/63 (97%)
Homeobox 789..842 CDD:278475 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4687
eggNOG 1 0.900 - - E1_KOG3802
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8655
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11636
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.