DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RHOF and chw-1

DIOPT Version :9

Sequence 1:NP_061907.2 Gene:RHOF / 54509 HGNCID:15703 Length:211 Species:Homo sapiens
Sequence 2:NP_505686.1 Gene:chw-1 / 184848 WormBaseID:WBGene00009059 Length:207 Species:Caenorhabditis elegans


Alignment Length:187 Identity:61/187 - (32%)
Similarity:104/187 - (55%) Gaps:12/187 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    18 KELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDR 82
            |.||.:.||:...||||:::.|:...:|.:|.|:.|:.::..|.|..|.:.|.|:|||||..:|.
 Worm     8 KCLKCIFVGNAAVGKTSMIVSYTTNVYPHNYVPTAFDNFSVVVLVDKKPIRLQLHDTAGQSSFDT 72

Human    83 LRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRA 147
            ||||.|.:..:.:|.|.|::..|:::|...|:||||....|..::|:|.:.|.|   .|:|.   
 Worm    73 LRPLCYTDADVFVIVYSVVDLQSFEDVSHHWYPEVTKRNPGTKLILVGTQADQR---WQVRG--- 131

Human   148 AQLEPITYMQGLSACEQIRAALYLECSAKFRENVEDVFREAAKVALSALKKAQRQKK 204
               ..:|.::|.:..::: .|.:.||||..:.|::.:|..|....|..  |..|:|:
 Worm   132 ---NTVTQLRGKALADRL-GAEFFECSALTQHNLKQMFDAAILAGLEG--KKNREKR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RHOFNP_061907.2 Rho4_like 17..211 CDD:206704 61/187 (33%)
RHO 22..195 CDD:197554 55/172 (32%)
Effector region. /evidence=ECO:0000255 48..56 3/7 (43%)
chw-1NP_505686.1 Wrch_1 10..172 CDD:133330 56/171 (33%)
RHO 12..174 CDD:197554 54/171 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0393
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091615at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.