DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC13 and CG17195

DIOPT Version :9

Sequence 1:NP_061901.2 Gene:ZDHHC13 / 54503 HGNCID:18413 Length:622 Species:Homo sapiens
Sequence 2:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster


Alignment Length:288 Identity:72/288 - (25%)
Similarity:108/288 - (37%) Gaps:115/288 - (39%)


- Green bases have known domain annotations that are detailed below.


Human   371 LAGAPFYFSF--------IFSIVAF-LYFFYKTWATDPGFTKASEEEKKVNII----------TL 416
            |....|:||.        :|..:|: ||:...|:.|.             ||:          :.
  Fly    32 LCSTAFFFSLQMFYIAPKVFGDIAYKLYWILVTFITH-------------NILGNMLACYMTSSS 83

Human   417 AETGSLDFRT----------FCTSC-LIRKPLRSLHCHVCNCCVARYDQHCLWTGRCIGFGNHHY 470
            ..|.|.|.|.          :|.|| .:|.| ||.||.:||.|:.|.|.||::||.|||..|..:
  Fly    84 VNTLSKDSRCPNPEDEPLWHYCESCKKLRSP-RSWHCVLCNTCILRRDHHCIFTGTCIGHNNQRF 147

Human   471 YIFFLFFLSM--------VCGWIIY--GSFIYLSSHCATTFKEDGLWTYLNQIVACSPWVLYILM 525
            :.:|.|:|::        .|.:|:.  |:|:.|||                        |::.|:
  Fly   148 FFWFTFYLTLGLVTSFATFCMFILQNGGNFMSLSS------------------------VIFNLI 188

Human   526 LATF--HFSWSTF----LLLN------QLFQIAFLGLTSHERISLQKQSKHMKQTLSLRKTPYN- 577
            ..||  :::.:||    .|||      ..|.:|:                 ..|.||...|.|| 
  Fly   189 TRTFFQNYTGNTFETIAFLLNISASYMPAFMLAY-----------------QMQILSQNSTYYNI 236

Human   578 ------LGFMQNLADFF-QCGCFGLVKP 598
                  |||.:|..... |.|.:..:.|
  Fly   237 FDCTYDLGFRKNCQTIMGQRGLWTFISP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC13NP_061901.2 ANK 1. /evidence=ECO:0000250|UniProtKB:Q8IUH5 43..78
ANK 79..192 CDD:238125
ANK repeat 81..112 CDD:293786
ANK 2. /evidence=ECO:0000255 81..110
ANK repeat 114..146 CDD:293786
ANK 3. /evidence=ECO:0000255 115..144
ANKYR <145..271 CDD:223738
ANK repeat 148..179 CDD:293786
ANK 4. /evidence=ECO:0000255 148..177
ANK repeat 181..247 CDD:293786
ANK 5. /evidence=ECO:0000255 181..211
ANK 6. /evidence=ECO:0000255 216..245
ANK 7. /evidence=ECO:0000255 249..277
zf-DHHC 423..559 CDD:307600 45/168 (27%)
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 47/172 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.