DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZDHHC13 and CG17197

DIOPT Version :9

Sequence 1:NP_061901.2 Gene:ZDHHC13 / 54503 HGNCID:18413 Length:622 Species:Homo sapiens
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:280 Identity:64/280 - (22%)
Similarity:111/280 - (39%) Gaps:72/280 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   329 FLTSLFPRFLVGYKNLVYLPTAFL---LSSVFWIFMTWFI----LFFPDLAGAPFYFSFIFSIVA 386
            :|....|:..|...:    |||.|   ::::|::.:..|.    ||  |:.|..:...::.:|..
  Fly    10 YLARRNPKIFVRISH----PTAVLFVIVTTIFFVVLQMFYVVPQLF--DVQGFMYKLGWLVAIFI 68

Human   387 FLYFFYKTWATDPGFTKAS-----------EEEKKVNIITLAETGSLDFRTFCTSCLIRKPLRSL 440
            ....|....|.....|...           |||.:.:              :|..|....|.||.
  Fly    69 TYNIFGNMLACHITSTSVESLPKDRQIPEPEEEHQWH--------------YCDVCEKLMPPRSW 119

Human   441 HCHVCNCCVARYDQHCLWTGRCIGFGNHHYYIFFLFFLSMVCGWIIYGSFIYLSSHCATTFKEDG 505
            ||.:|.||:.:.|:||::|..|:|..|..|:.:|..|:::       |:.:.|::|...|.|   
  Fly   120 HCILCKCCILKRDRHCIFTASCVGHNNQRYFFWFTLFMAL-------GTGVALATHIIATLK--- 174

Human   506 LWTYLNQIVACSP-------WVLYILMLATFHFSWSTFLLLNQLFQIAFLGLTSHERISLQKQSK 563
            .::|.:.|....|       |::..|:|.|:.|:.....:|.||..:...| |.|:..|      
  Fly   175 YFSYSDLIFLNIPRDNLPPFWLVITLILNTYVFAAPVSSVLMQLSVLKNNG-TLHKFYS------ 232

Human   564 HMKQTLSLRKTPYNLGFMQN 583
                      ..|:||..:|
  Fly   233 ----------DTYDLGLWEN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZDHHC13NP_061901.2 ANK 1. /evidence=ECO:0000250|UniProtKB:Q8IUH5 43..78
ANK 79..192 CDD:238125
ANK repeat 81..112 CDD:293786
ANK 2. /evidence=ECO:0000255 81..110
ANK repeat 114..146 CDD:293786
ANK 3. /evidence=ECO:0000255 115..144
ANKYR <145..271 CDD:223738
ANK repeat 148..179 CDD:293786
ANK 4. /evidence=ECO:0000255 148..177
ANK repeat 181..247 CDD:293786
ANK 5. /evidence=ECO:0000255 181..211
ANK 6. /evidence=ECO:0000255 216..245
ANK 7. /evidence=ECO:0000255 249..277
zf-DHHC 423..559 CDD:307600 40/142 (28%)
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 14/65 (22%)
zf-DHHC 100..>198 CDD:279823 31/121 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11709
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.