DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZFAND6 and Rabex-5

DIOPT Version :10

Sequence 1:NP_061879.2 Gene:ZFAND6 / 54469 HGNCID:30164 Length:208 Species:Homo sapiens
Sequence 2:NP_612093.1 Gene:Rabex-5 / 38144 FlyBaseID:FBgn0262937 Length:696 Species:Drosophila melanogaster


Alignment Length:138 Identity:31/138 - (22%)
Similarity:52/138 - (37%) Gaps:47/138 - (34%)


- Green bases have known domain annotations that are detailed below.


Human     9 QVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSESLPVQCTDGSVPE 73
            |..:.|.:||||||.|:..|:||:|::|...                                 :
  Fly    14 QQDLKCRSGCGFYGTPQNEGLCSMCFREKFN---------------------------------D 45

Human    74 AQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDKAVPETEDVQASVSDTAQQPSEEQSKS 138
            .|..|..|.....|..       |.|||       ::|:..|:...:|..|....::||:::..:
  Fly    46 KQRKLKQTGGETGPGS-------SSSVA-------TLDRRSPQHAHLQGKVEQQVRKPSDKEQDN 96

Human   139 LEKPKQKK 146
            |...::||
  Fly    97 LGTLQKKK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZFAND6NP_061879.2 zf-A20 12..35 CDD:460313 12/22 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..140 14/98 (14%)
ZnF_AN1 149..186 CDD:197545
Rabex-5NP_612093.1 zf-A20 17..40 CDD:460313 12/22 (55%)
DUF5601 163..220 CDD:465668
VPS9 274..373 CDD:460489
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.