DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATAD2B and Rpt6R

DIOPT Version :9

Sequence 1:XP_011531220.1 Gene:ATAD2B / 54454 HGNCID:29230 Length:1511 Species:Homo sapiens
Sequence 2:NP_651811.1 Gene:Rpt6R / 43635 FlyBaseID:FBgn0039788 Length:399 Species:Drosophila melanogaster


Alignment Length:435 Identity:130/435 - (29%)
Similarity:216/435 - (49%) Gaps:88/435 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   256 TEGEEEARTSKLLPLE---------KISIESQEEDGDIEV----EEAEGEENDRPYNLRQRKTVD 307
            :||.....|.|:..|:         .:.:::|..:.:::|    ||.:..:....|.....|.:|
  Fly    11 SEGFHSYYTQKISELQFTVNERQKNLLRLQAQRNELNLKVRLLREELQLLQEQGSYIAEVVKPMD 75

Human   308 RYQAPPIVPAHQKKRENTLFDIHR-------SPARRSHIRRKKHAIHSSDTTSSDEERFERRKSK 365
            :.:.  :|..|.:.:  .:.|:.:       :|:.|..:|.:.:.:|                  
  Fly    76 KNKV--LVKVHPEGK--YVVDVDKTINIKDVTPSSRVALRNESYTLH------------------ 118

Human   366 SMARARNRCLPMNFRAEDLASGILRERVKVGASLADVDPMNIDKSVRFDSIGGLSHHIHALKEMV 430
                   :.||.  :.:.|.|.:|.|:|.             |.:  ::.:|||...|..:||::
  Fly   119 -------KILPN--KVDPLVSLMLVEKVP-------------DST--YEMVGGLDKQIQEIKEVI 159

Human   431 VFPLLYPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALAN--ECSQGDKKVAFFMRKGADCLSKW 493
            ..|:.:||:|:...|..|:|.|.||||||||||:|||:|:  ||:       |....|::.:.|:
  Fly   160 ELPVKHPELFDALGITQPKGVLLYGPPGTGKTLLARAVAHHTECT-------FIRVSGSELVQKF 217

Human   494 VGESERQLRLLFDQAYLMRPSIIFFDEID--GLAPVRSSRQDQIHSSIVSTLLAL---MDGLDNR 553
            :||..|.:|.||..|....|||||.||||  |.|.:.:...|   |.:..|:|.|   :||.:..
  Fly   218 IGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARLETGTGD---SEVQRTMLELLNQLDGFEAT 279

Human   554 GEIVVIGATNRLDSIDPALRRPGRFDREFLFNLPDQKARKHILQIHTRDWNPKLSDAF-LGELAE 617
            ..|.||.||||:|.:|.||.||||.||:..|..|:::||..||:||:|..|  |:... |.::||
  Fly   280 KNIKVIMATNRIDVLDQALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMN--LTRGINLRKIAE 342

Human   618 KCVGYCGADIKALCTEAALIALRRRYPQIYASSHKLQLDVSSIVL 662
            :..|..||::|.:||||.:.|||.|  :::.:....::.||.:::
  Fly   343 EMPGASGAEVKGVCTEAGMYALRER--RVHVTQEDFEMAVSKVMM 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATAD2BXP_011531220.1 AAA 447..588 CDD:214640 65/147 (44%)
AAA 452..586 CDD:278434 63/140 (45%)
COG5076 866..>1100 CDD:227408
Bromo_AAA 974..1085 CDD:99957
Rpt6RNP_651811.1 RPT1 3..396 CDD:224143 130/435 (30%)
AAA 180..311 CDD:278434 62/140 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.