DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NLGN3 and CG30095

DIOPT Version :10

Sequence 1:NP_851820.1 Gene:NLGN3 / 54413 HGNCID:14289 Length:848 Species:Homo sapiens
Sequence 2:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster


Alignment Length:150 Identity:31/150 - (20%)
Similarity:52/150 - (34%) Gaps:48/150 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   316 SALSSWAVNYQP--VKYTSLLADKVGCNVLDTVDMVDCLRQKSAKELVEQDIQPARYHVAFGPVI 378
            :|...|.  |.|  :||....|.:...|..|:.....|.:....||             .|.|:.
  Fly    78 AAKGKWP--YVPGFMKYRVDNAARSFFNQNDSFIKQFCTKWIQVKE-------------CFRPLF 127

Human   379 DGDVIPDDPEILME------QGEFLNYDIMLGVNQGEGLKFVEGVVDPEDGVSGTDFDYSVSNFV 437
            |..   ::.::.:|      ||:..|.|.:|              :..|..|....||   .|::
  Fly   128 DKS---NNTDVEVETLDAKIQGQRCNCDKLL--------------LSTEPPVPVVYFD---KNYI 172

Human   438 DNLYGYPEGKDTLRETIKFM 457
            .|:     ..:|:..||:|:
  Fly   173 GNV-----SSETILNTIEFL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NLGN3NP_851820.1 COesterase 40..624 CDD:395084 31/149 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..195
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 645..694
CG30095NP_725529.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.