DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDAP1 and GstD6

DIOPT Version :9

Sequence 1:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:263 Identity:48/263 - (18%)
Similarity:87/263 - (33%) Gaps:82/263 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    28 LYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQ 92
            ||:.:.|.|::.|.:......::.....|:..:.|..||||:::|....:|.|:....:|.|...
  Fly     3 LYNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRA 67

Human    93 IIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYAT 157
            |:.||.:.:          .|:...||:                            |....|...
  Fly    68 IVVYLVEQY----------GKDDSLYPK----------------------------DPQKQALIN 94

Human   158 TRIRSQIGNTESELKK-----LAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLD 217
            .|:...:|.....:.|     |....|..||                 |::.|....|.|...||
  Fly    95 QRLYFDMGTLYDGIAKYFFPLLRTGKPGTQE-----------------NLEKLNAAFDLLNNFLD 142

Human   218 QVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYER 282
                             .|.::.|...::||:.:..|:...:.:.|..:     |.||::.:|:.
  Fly   143 -----------------GQDYVAGNQLSVADIVILATVSTTEMVDFDLK-----KFPNVDRWYKN 185

Human   283 VLK 285
            ..|
  Fly   186 AQK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 18/69 (26%)
GST_C_GDAP1 179..289 CDD:198336 20/107 (19%)
Required for mitochondrial localization 320..358
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 19/70 (27%)
PLN02395 11..208 CDD:166036 45/255 (18%)
GST_C_Delta_Epsilon 88..204 CDD:198287 25/140 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154508
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.