DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDAP1 and GstD5

DIOPT Version :9

Sequence 1:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:251 Identity:47/251 - (18%)
Similarity:87/251 - (34%) Gaps:84/251 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    42 LVIAEKALKCEEHDVSLPLSEHNE--PWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDE 104
            :::..|||..:.:...|...|.::  |.|::||....:|.|:.....|.|:..|..||.:.:..:
  Fly    15 VIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKD 79

Human   105 RT--PRLMPDKESMYYPRVQHYRE---LLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQI 164
            .|  |: .|.|:::...|:  |.:   |.||.....|                |.:.|.:     
  Fly    80 DTLFPK-DPKKQALVNQRL--YFDMGTLYDSFAKYYY----------------PLFHTGK----- 120

Human   165 GNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEE 229
            ..::.:.||:                        ..:.:||...|                    
  Fly   121 PGSDEDFKKI------------------------ESSFEYLNIFL-------------------- 141

Human   230 TPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLK 285
               |||. ::.|:..|:||:::..|:...:...|     ...|.||:..:|....|
  Fly   142 ---EGQN-YVAGDHLTVADIAILSTVSTFEIFDF-----DLNKYPNVARWYANAKK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 15/57 (26%)
GST_C_GDAP1 179..289 CDD:198336 17/107 (16%)
Required for mitochondrial localization 320..358
GstD5NP_524914.3 GstA 1..184 CDD:223698 45/245 (18%)
GST_N_Delta_Epsilon 1..74 CDD:239343 16/58 (28%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/177 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.