DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDAP1 and GstD2

DIOPT Version :9

Sequence 1:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens
Sequence 2:NP_524912.1 Gene:GstD2 / 48335 FlyBaseID:FBgn0010038 Length:215 Species:Drosophila melanogaster


Alignment Length:259 Identity:48/259 - (18%)
Similarity:82/259 - (31%) Gaps:100/259 - (38%)


- Green bases have known domain annotations that are detailed below.


Human    42 LVIAEKALKCEEHDVSLPLSEHNE--PWFMRLNSTGEVPVLIHGENIICEATQIIDYL-----EQ 99
            :::..|||..|.:...|...|..:  |.|::||....:|.|:.....|.|:..|..||     :.
  Fly    15 VIMVAKALGLELNKKLLNTMEGEQLKPEFVKLNPQHTIPTLVDNGFSIWESRAIAVYLVEKYGKD 79

Human   100 TFLDERTP--------RLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYA 156
            .:|....|        ||..|..::|....::|                           .|.:.
  Fly    80 DYLLPNDPKKRAVINQRLYFDMGTLYESFAKYY---------------------------YPLFR 117

Human   157 TTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVET 221
            |.:..|                                   |.|    ||:|    |.....::|
  Fly   118 TGKPGS-----------------------------------DED----LKRI----ETAFGFLDT 139

Human   222 ELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLK 285
            .|         |||: ::.|:..|:||:::..|:..     |....:...|..|:..:|:...|
  Fly   140 FL---------EGQE-YVAGDQLTVADIAILSTVST-----FEVSEFDFSKYSNVSRWYDNAKK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 17/62 (27%)
GST_C_GDAP1 179..289 CDD:198336 21/107 (20%)
Required for mitochondrial localization 320..358
GstD2NP_524912.1 GST_N_Delta_Epsilon 1..74 CDD:239343 17/58 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 29/186 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.