DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDAP1 and GstE11

DIOPT Version :9

Sequence 1:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens
Sequence 2:NP_001286575.1 Gene:GstE11 / 37128 FlyBaseID:FBgn0034354 Length:225 Species:Drosophila melanogaster


Alignment Length:291 Identity:60/291 - (20%)
Similarity:100/291 - (34%) Gaps:90/291 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    25 KLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICE 89
            |.|||:...|...:.|.|..|...|:.:...|::...||....|::||:...:|||.....|:.:
  Fly     4 KPILYYAPRSPPCRAVLLTAAALGLELDLRLVNVKAGEHKSAEFLKLNAQHTIPVLDDNGTIVSD 68

Human    90 ATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPA 154
            :..|..||...:        .|:.:...||:....|.|:|:                        
  Fly    69 SHIICSYLADKY--------APEGDDSLYPKDPEKRRLVDA------------------------ 101

Human   155 YATTRIRSQIGNTESELKKLAE--------ENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDE 211
                |:....|:....::.:.|        |.|.                   |.|.||:|..|.
  Fly   102 ----RLYYDCGHLFPRIRFIVEPVIYFGAGEVPS-------------------DRVAYLQKAYDG 143

Human   212 LEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLG------FARR-NWG 269
            ||..|               .||.  :|.|:..|:||:|...::...:...      |.|. .| 
  Fly   144 LEHCL---------------AEGD--YLVGDKLTIADLSCIASVSTAEAFAPIEPDQFPRLVQW- 190

Human   270 NGKRPNLETYYERVLKRKTFNKVLGHVNNIL 300
             .||.....||:: ..::..:.::|.|..:|
  Fly   191 -VKRIQALPYYQK-NNQEGLDMLVGLVKGLL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 20/71 (28%)
GST_C_GDAP1 179..289 CDD:198336 25/116 (22%)
Required for mitochondrial localization 320..358
GstE11NP_001286575.1 GstA 5..198 CDD:223698 54/266 (20%)
GST_N_Delta_Epsilon 5..78 CDD:239343 21/72 (29%)
GST_C_Delta_Epsilon 94..211 CDD:198287 32/183 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154578
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.