DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDAP1 and GstE6

DIOPT Version :9

Sequence 1:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens
Sequence 2:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster


Alignment Length:236 Identity:52/236 - (22%)
Similarity:80/236 - (33%) Gaps:65/236 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    24 VKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIIC 88
            |||.||....|...:.|:|.:|...|..|..:|.:.......|.::..|....||.|....:.|.
  Fly     2 VKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIW 66

Human    89 EATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIP 153
            ::..||.||...:.|          ....||:....|.::|..          ||.|..|     
  Fly    67 DSHAIIAYLVSKYAD----------SDALYPKDPLKRAVVDQR----------LHFESGV----- 106

Human   154 AYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQ 218
            .:| ..|||                             :...:|.....|..|:..|.:.::.|.
  Fly   107 VFA-NGIRS-----------------------------ISKSVLFQGQTKVPKERYDAIIEIYDF 141

Human   219 VETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLK 259
            |||.|:          .|.::.|...|:||.||..::..|:
  Fly   142 VETFLK----------GQDYIAGNQLTIADFSLVSSVASLE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 19/71 (27%)
GST_C_GDAP1 179..289 CDD:198336 17/81 (21%)
Required for mitochondrial localization 320..358
GstE6NP_611328.1 GstA 4..196 CDD:223698 50/234 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/72 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/137 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.