DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDAP1 and GstE1

DIOPT Version :9

Sequence 1:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:232 Identity:47/232 - (20%)
Similarity:77/232 - (33%) Gaps:70/232 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    26 LILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICEA 90
            ::||....|...:.|:|.:....|..|..:|:|...||....:::.|....||:|......|.::
  Fly     6 IVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDS 70

Human    91 TQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAY 155
            ..|..||...:.          |....||:....|              .|::..|..|:.:   
  Fly    71 HAIAAYLVDKYA----------KSDELYPKDLAKR--------------AIVNQRLFFDASV--- 108

Human   156 ATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLD--HDNVKYLKKILDELEKVLDQ 218
                |.:.|.|..             :..:|.....:..:.||  |..:|.|:..|         
  Fly   109 ----IYASIANVS-------------RPFWINGVTEVPQEKLDAVHQGLKLLETFL--------- 147

Human   219 VETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTL 255
                           |..|:|.|:|.||||:|...|:
  Fly   148 ---------------GNSPYLAGDSLTLADLSTGPTV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 18/71 (25%)
GST_C_GDAP1 179..289 CDD:198336 18/79 (23%)
Required for mitochondrial localization 320..358
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 19/72 (26%)
GstA 8..197 CDD:223698 47/230 (20%)
GST_C_Delta_Epsilon 94..210 CDD:198287 25/134 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.