DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDAP1 and GstE10

DIOPT Version :9

Sequence 1:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:243 Identity:55/243 - (22%)
Similarity:99/243 - (40%) Gaps:44/243 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    26 LILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICEA 90
            ||||....|...:.|.|.:....|..|.|.:.:...:|.:|..:|.|....||:|..||:.|.::
  Fly     4 LILYGTESSPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDS 68

Human    91 TQIIDYLEQTFL--DERTP-----RLMPDKESMY---------YPRVQH--YRELLDSLP----- 132
            ..||.||...:.  ||..|     |.:.|:...:         :.::|.  ::|....:|     
  Fly    69 HAIIGYLVNKYAQSDELYPKDPLKRAVVDQRLHFETGVLFHGIFKQLQRALFKENATEVPKDRLA 133

Human   133 --MDAYT--------HGCILHPELTV-DSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYI 186
              .|||.        :..:..|:||: |..|.|..:|...|......::..||:        |::
  Fly   134 ELKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLS--------AWL 190

Human   187 AKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEG 234
            |:...|  ...:.||::..:.:.|::...|.:...:|.::..|..:.|
  Fly   191 ARISAL--PFYEEDNLRGARLLADKIRSKLPKQFDKLWQKAFEDIKSG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 23/71 (32%)
GST_C_GDAP1 179..289 CDD:198336 10/56 (18%)
Required for mitochondrial localization 320..358
GstE10NP_001286570.1 GstA 4..197 CDD:223698 48/202 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 24/72 (33%)
GST_C_Delta_Epsilon 91..211 CDD:198287 23/129 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.