DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDAP1 and GstT3

DIOPT Version :9

Sequence 1:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens
Sequence 2:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster


Alignment Length:318 Identity:63/318 - (19%)
Similarity:104/318 - (32%) Gaps:99/318 - (31%)


- Green bases have known domain annotations that are detailed below.


Human     9 RGSPPLRAEGKADAEVKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEH-NEPWFMRLN 72
            |.|.|:|            .|:...|..|:.:.::.....:..|:..|:|...|| .|.:...:|
  Fly    40 RMSAPIR------------YYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEIN 92

Human    73 STGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRE---LLDSLPMD 134
            ....||.:......:.|:..|:.||.   ...:.|..:..|..:...||..:.|   :...|...
  Fly    93 RFQRVPCIHDNGYKLAESVAILRYLS---AKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCA 154

Human   135 AYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDH 199
            .|.....|.|.||                 |.|.||.|                           
  Fly   155 MYFRTVWLEPLLT-----------------GRTPSEAK--------------------------- 175

Human   200 DNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFA 264
                 ::....::|:.||.|        ||...||:. :|.|.|.|:||:..|..:.:.:...:.
  Fly   176 -----IETFRMQMERNLDVV--------EEVWLEGKD-FLTGSSLTVADIFAACEIEQTRMADYD 226

Human   265 RRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGT 322
            .|.    |.|.:..:.:||  |::.|..                :.||.:...|:.||
  Fly   227 VRI----KYPKIRAWLKRV--RQSCNPY----------------YDVAHEFVYKISGT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 15/72 (21%)
GST_C_GDAP1 179..289 CDD:198336 21/109 (19%)
Required for mitochondrial localization 320..358 2/3 (67%)
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 17/90 (19%)
GstA 47..243 CDD:223698 52/262 (20%)
GST_C_Theta 135..259 CDD:198292 38/203 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.