DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDAP1 and SPOM_SPCC1183.02

DIOPT Version :10

Sequence 1:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens
Sequence 2:NP_587885.1 Gene:SPOM_SPCC1183.02 / 2539015 PomBaseID:SPCC1183.02 Length:220 Species:Schizosaccharomyces pombe


Alignment Length:127 Identity:28/127 - (22%)
Similarity:45/127 - (35%) Gaps:42/127 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   201 NVKYLKKILDE-LEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFA 264
            |:.|.:|...| ..:.:|.::...:...:.|       :|.|:.|||||:          |.|..
pombe   123 NIPYEEKPFKESATRAIDSLKIPNELVKDRT-------YLVGDRFTLADL----------FFGSL 170

Human   265 RRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAV------------LPTAFRVAKK 314
                       |..::..::..|| .|.|.|:....|:..            ||....||||
pombe   171 -----------LRIFFNSIIDEKT-RKELPHLTRYYITMFHQAKLETYFPLELPLTVTVAKK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350
GST_C_GDAP1 179..289 CDD:198336 17/88 (19%)
Required for mitochondrial localization 320..358
SPOM_SPCC1183.02NP_587885.1 GST_N_EF1Bgamma 4..76 CDD:239342
GST_C_EF1Bgamma_like 92..217 CDD:198290 24/122 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.