DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDAP1 and Y53G8B.1

DIOPT Version :10

Sequence 1:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens
Sequence 2:NP_497662.1 Gene:Y53G8B.1 / 190243 WormBaseID:WBGene00021817 Length:213 Species:Caenorhabditis elegans


Alignment Length:92 Identity:29/92 - (31%)
Similarity:46/92 - (50%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    25 KLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICE 89
            |.|||....|..|.:||..:|.|.:..|...|:| |::..|..|...|...:||:|......:.|
 Worm     4 KPILYSSWSSGCSSRVRTALALKKIDYEYQPVNL-LNKQKEQEFHGNNPAEKVPILKINGLTLTE 67

Human    90 ATQIIDYLEQTFLDERTPRLMPDKESM 116
            :..||:||::.:.|   |.|:|.:..:
 Worm    68 SMAIIEYLDEIYPD---PPLLPKEPEL 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350 23/71 (32%)
GST_C_GDAP1 179..289 CDD:198336
Required for mitochondrial localization 320..358
Y53G8B.1NP_497662.1 maiA 18..211 CDD:273527 23/78 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.