DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDAP1 and exl-1

DIOPT Version :10

Sequence 1:NP_061845.2 Gene:GDAP1 / 54332 HGNCID:15968 Length:358 Species:Homo sapiens
Sequence 2:NP_497000.1 Gene:exl-1 / 175100 WormBaseID:WBGene00001371 Length:238 Species:Caenorhabditis elegans


Alignment Length:215 Identity:41/215 - (19%)
Similarity:70/215 - (32%) Gaps:71/215 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   134 DAYTH----GCILHPE-----------LTVDSMIPAYATTRIR------------SQIGNTESE- 170
            |.|.|    .|:.|.:           ..|:.....:..|.:|            :|...||.: 
 Worm    20 DPYAHHLFMRCLYHAKHDPTMKFDVKTTNVNKTSQEFKNTGLRRMPGISAEESGETQTFETEDDI 84

Human   171 ---LKKLAEENPDLQEAYIA-----KQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRN 227
               |:.|..|..|.:||..|     :|.....|.::|.:..:..::| .|:|.|.:.||:     
 Worm    85 LDFLEYLKPERGDDEEAENATCDLFRQFARFVKDVEHRDTAFNTELL-RLDKYLSEQETK----- 143

Human   228 EETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKV 292
                      :|..:..|..|..:...||.::...                   ::||.......
 Worm   144 ----------FLISDDVTHIDCLVLTRLHSIRVAA-------------------KMLKNYEIPAD 179

Human   293 LGHVNNILISAVLPTAFRVA 312
            |.||.:.|.:......|||:
 Worm   180 LSHVLDYLKAGYATEMFRVS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDAP1NP_061845.2 GST_N_GDAP1 26..98 CDD:239350
GST_C_GDAP1 179..289 CDD:198336 20/114 (18%)
Required for mitochondrial localization 320..358
exl-1NP_497000.1 GST_C_family 98..210 CDD:470672 26/137 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.