DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpa3 and CG32379

DIOPT Version :9

Sequence 1:NP_062173.1 Gene:Cpa3 / 54242 RGDID:2390 Length:417 Species:Rattus norvegicus
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:353 Identity:106/353 - (30%)
Similarity:183/353 - (51%) Gaps:33/353 - (9%)


- Green bases have known domain annotations that are detailed below.


  Rat    82 LEQHKMDYEILINDL--------QEEIDKQFDVK----EEIAGRHSYAKYNDWNKIVSWTEKMVE 134
            :..:.::|::||.||        .|.:.|:..::    :.::..:::::.||      :.:.::|
  Fly     1 MRNYHLEYKVLIEDLAPLVHAQRAENLRKKLLIQWPHIDVLSAFYTHSEIND------YLDSLLE 59

  Rat   135 KHPEMVSRIKIGSTVEDNPLYVLKIGRKDGERK--AIFMDCGIHAREWVSPAFCQWFVYQAAKSY 197
            :.|:.|...:.|.:.|..||.||.|...||.|.  .|.:|..:|||||:||:...:.:.|...:|
  Fly    60 RFPKRVQVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNY 124

  Rat   198 GKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTKDRMWRKNRSKNPNSTCIGTDLNRNFDVSW--DS 260
            |.|:   :||...::.::||.|.|||.::.|..|.|||:|....|..|||||:||||...|  |.
  Fly   125 GDNQ---ELLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDE 186

  Rat   261 SPNTDNPCLSVYRGPAPESEKETKAVTNFIRSHLNSIKAYITFHSYSQMLLFPYGYTIKLPPNHQ 325
            ..::| ||.::|||..|..:.|::.:.:.:..:...:..|::.|||....|.|:|||...|..:|
  Fly   187 GSSSD-PCENIYRGERPFDQSESQVLRDVMLHYKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQ 250

  Rat   326 DLLKVARIATDVLSSRYETR--YIYGPIASTIYKTSGSSLDWAYDLGIKHTFA--FELRDKGKSG 386
            |::.||......:.  |.|.  |.||.....:|.|||.:.|:|:.: :..|.|  .||...|..|
  Fly   251 DMMSVADAGAKAII--YSTNGIYSYGSTYYVLYPTSGDTTDFAFGV-VNATVAMTMELPAAGFQG 312

  Rat   387 FLLPESRIKPTCKETMLSVKFIAKYILK 414
            |....|:|:....|:.:.|:.:|..:::
  Fly   313 FDPWISQIERLVTESWVGVRAMAAEVIR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpa3NP_062173.1 Propep_M14 28..102 CDD:280416 6/27 (22%)
Peptidase_M14_like 114..413 CDD:299699 99/306 (32%)
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 99/306 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351625
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.