DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf5 and CG32847

DIOPT Version :9

Sequence 1:NP_062276.1 Gene:Rnf5 / 54197 MGIID:1860076 Length:180 Species:Mus musculus
Sequence 2:NP_730026.1 Gene:CG32847 / 318245 FlyBaseID:FBgn0052847 Length:164 Species:Drosophila melanogaster


Alignment Length:162 Identity:67/162 - (41%)
Similarity:97/162 - (59%) Gaps:19/162 - (11%)


- Green bases have known domain annotations that are detailed below.


Mouse    25 FECNICLETAREAVVSVCGHLYCWPCLHQWLETRPDRQECPVCKAGISREKVVPLYGRGSQKPQD 89
            :||||||:||:.||||:||||:|||||:||:.|:||...|||||:|:.|.||:|:|.|..::.:|
  Fly    16 YECNICLDTAQNAVVSMCGHLFCWPCLYQWILTKPDHTVCPVCKSGVDRSKVIPVYARNDKRQED 80

Mouse    90 PRLKTPPRPQGQRPAPESRGGFQPFG---DAGGF-HFSFGVGAFPFGFFTTVFNAHEPFRRGA-- 148
            ||.||||||.|.         :..:.   :.|.| :..||: .||:|..::..:..||....|  
  Fly    81 PRDKTPPRPTGI---------WSDYANDLELGLFSYLLFGL-FFPYGALSSYLDMDEPLNPAADH 135

Mouse   149 GVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI 180
            |:..||.....|   ..||::||....:::.|
  Fly   136 GIRDGQNETLLS---KFFLYVAIMLIIYMIVI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf5NP_062276.1 PLN03208 25..>117 CDD:178747 48/94 (51%)
RING-HC_RNF5 25..70 CDD:319657 31/44 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 12/30 (40%)
CG32847NP_730026.1 PLN03208 4..>91 CDD:178747 47/74 (64%)
RING 17..60 CDD:238093 30/42 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842609
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.