DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPIL3 and Moca-cyp

DIOPT Version :10

Sequence 1:NP_115861.1 Gene:PPIL3 / 53938 HGNCID:9262 Length:165 Species:Homo sapiens
Sequence 2:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster


Alignment Length:158 Identity:62/158 - (39%)
Similarity:81/158 - (51%) Gaps:20/158 - (12%)


- Green bases have known domain annotations that are detailed below.


Human     9 VGDIKIEVFCERTPKTCE-MESRCVPQAGVQWRDLGSLQPPPPGFKQVFCLSLPR---------- 62
            :|.|..|:|.:..|||.| ..:.|..:.|     .|.:......:|.|....:.:          
  Fly    26 MGRIVFELFNDVAPKTAENFRALCTGEKG-----FGLITGKKLQYKGVIFHRVVKDFMVQAGDFS 85

Human    63 --TGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKV 125
              .|.||.||:|..||||..| .||:...::||||.|.||||||||||....||||..:.|||:|
  Fly    86 AGNGTGGESIYGGTFEDESFE-KKHDRPFLLSMANRGKNTNGSQFFITTQPAPHLDNIHVVFGQV 149

Human   126 IDGLETLDELEKLPVNEKTYRPLNDVHI 153
            |.|.|.:.:||.||| ::..|||.|..|
  Fly   150 ISGQELVRQLEGLPV-DRNSRPLQDAAI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPIL3NP_115861.1 cyclophilin 1..158 CDD:469651 62/158 (39%)
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:469651 62/158 (39%)
PRK12678 612..>804 CDD:237171
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.