DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FGFRL1 and CG31431

DIOPT Version :9

Sequence 1:XP_024309860.1 Gene:FGFRL1 / 53834 HGNCID:3693 Length:527 Species:Homo sapiens
Sequence 2:NP_001247231.1 Gene:CG31431 / 326138 FlyBaseID:FBgn0051431 Length:361 Species:Drosophila melanogaster


Alignment Length:346 Identity:79/346 - (22%)
Similarity:128/346 - (36%) Gaps:90/346 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   182 VIARPVGSSVRLKCVASG------------------------HPRPDI---TWMKDDQALTRPEA 219
            :|.:..|..|:|:|...|                        |....:   |.:..:.:|.||| 
  Fly    40 LIQQRAGFDVKLQCNLKGLVDESMLNDIKIHWYFKQCSENNCHQLGSVDEWTALPCEPSLCRPE- 103

Human   220 AEPRKKKWTLSLKNLRPEDSGKYTCRVS----NRAGAINA----TYKVDVIQRTRSKPVLTGTHP 276
                     |.|:|:....||.|.|.::    ::|.|::.    ||::||...:.:.|....::|
  Fly   104 ---------LWLRNVTERYSGLYKCSINPHIWDKAQAVDVQLVRTYQLDVKNTSLAAPEFVDSYP 159

Human   277 VNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEY-----GAEGR--------HNSTIDVGGQKFVV 328
            .|.|...|....|||:|.|:..|.|:|.:|..|     |.|..        .|..:...|:.:.:
  Fly   160 NNKTTLVGSRVVFQCRVHSEEHPTIKWFRRQTYVGTQSGGEASSAPTTSNFSNHIVRYNGRTYEL 224

Human   329 LPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPD------------ 381
            |.|..........||:||::...|..|||.|.|:..:..|:..|.|||.||.|            
  Fly   225 LSTDPEKMMAPQIYLSKLILDGVRLRDAGHYACVAISYRGHKIREAFLDVLADVEDTDQENEYWS 289

Human   382 ---PKPPGPPVASSSSATSLPWPVVIGIPAGAVFILGTLLLWLCQAQKKPCTPAPAPPLPGHRPP 443
               .:..|.|.:....     :.::..:|.|...:  .|.:|......|.|:       .||   
  Fly   290 DYGNEDEGVPTSDRRE-----FLLLFLMPLGLALL--PLTVWFSYLLYKRCS-------VGH--- 337

Human   444 GTARDRSGDKDLPSLAALSAG 464
            |..:....|:||.:...:..|
  Fly   338 GDCQRIDSDEDLDTERCVLGG 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FGFRL1XP_024309860.1 I-set 56..139 CDD:254352
Ig2_FGFRL1-like 180..261 CDD:143264 23/113 (20%)
Ig 284..378 CDD:325142 32/106 (30%)
CG31431NP_001247231.1 IG_like 159..274 CDD:214653 35/114 (31%)
Ig 167..275 CDD:299845 32/107 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143159
Domainoid 1 1.000 47 1.000 Domainoid score I12100
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7169
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19890
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.