DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRKAG3 and aakg-3

DIOPT Version :10

Sequence 1:NP_059127.2 Gene:PRKAG3 / 53632 HGNCID:9387 Length:489 Species:Homo sapiens
Sequence 2:NP_508509.3 Gene:aakg-3 / 189836 WormBaseID:WBGene00021527 Length:425 Species:Caenorhabditis elegans


Alignment Length:46 Identity:14/46 - (30%)
Similarity:23/46 - (50%) Gaps:2/46 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   470 SEPVLTLLLSSKKGRKFVYAGSNSGVVQAPLAFCEKHGSCED--CV 513
            |.|::|:..||......|..||:...::.|:....:|.:|.|  ||
 Worm   117 SLPLVTVPASSYSKESAVVWGSSPDHLEVPMKAYHQHSTCSDSPCV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRKAG3NP_059127.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..113
CBS_euAMPK_gamma-like_repeat1 192..329 CDD:341388
CBS repeat 200..273 CDD:341388
CBS repeat 285..329 CDD:341388
AMPK pseudosubstrate 293..314
CBS_euAMPK_gamma-like_repeat2 355..478 CDD:341399 3/7 (43%)
CBS repeat 356..421 CDD:341399
CBS repeat 432..475 CDD:341399 2/4 (50%)
aakg-3NP_508509.3 CBS_pair_SF 103..255 CDD:449531 14/46 (30%)
CBS repeat 111..198 CDD:341358 14/46 (30%)
CBS repeat 211..255 CDD:341358
CBS_pair_SF 281..408 CDD:449531
CBS repeat 282..347 CDD:341358
CBS repeat 362..405 CDD:341358
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.