| Sequence 1: | NP_059127.2 | Gene: | PRKAG3 / 53632 | HGNCID: | 9387 | Length: | 489 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_508509.3 | Gene: | aakg-3 / 189836 | WormBaseID: | WBGene00021527 | Length: | 425 | Species: | Caenorhabditis elegans |
| Alignment Length: | 46 | Identity: | 14/46 - (30%) |
|---|---|---|---|
| Similarity: | 23/46 - (50%) | Gaps: | 2/46 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Human 470 SEPVLTLLLSSKKGRKFVYAGSNSGVVQAPLAFCEKHGSCED--CV 513 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| PRKAG3 | NP_059127.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..113 | ||
| CBS_euAMPK_gamma-like_repeat1 | 192..329 | CDD:341388 | |||
| CBS repeat | 200..273 | CDD:341388 | |||
| CBS repeat | 285..329 | CDD:341388 | |||
| AMPK pseudosubstrate | 293..314 | ||||
| CBS_euAMPK_gamma-like_repeat2 | 355..478 | CDD:341399 | 3/7 (43%) | ||
| CBS repeat | 356..421 | CDD:341399 | |||
| CBS repeat | 432..475 | CDD:341399 | 2/4 (50%) | ||
| aakg-3 | NP_508509.3 | CBS_pair_SF | 103..255 | CDD:449531 | 14/46 (30%) |
| CBS repeat | 111..198 | CDD:341358 | 14/46 (30%) | ||
| CBS repeat | 211..255 | CDD:341358 | |||
| CBS_pair_SF | 281..408 | CDD:449531 | |||
| CBS repeat | 282..347 | CDD:341358 | |||
| CBS repeat | 362..405 | CDD:341358 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||