DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and BCL2L14

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001357197.1 Gene:BCL2L14 / 79370 HGNCID:16657 Length:327 Species:Homo sapiens


Alignment Length:265 Identity:48/265 - (18%)
Similarity:93/265 - (35%) Gaps:79/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SDWKALRGGVGGGAGGPGSVPNPSNGRSLHAGGPMTRAASTSSLASSTRTMTNYQ---EYK---- 94
            |.|||..|.|       ....:.|....:.|.|..|.....|.....:|.::|.:   |::    
Human    91 SSWKAFFGVV-------EKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDP 148

  Fly    95 --MDIINQGKCLCGQYIRARLRRAGVLNRK---VTQ----RLRNILDPGSS-------HVVYEVF 143
              :.|.|:...:...:...:..:||....|   ||:    :|:..:...||       .::.::.
Human   149 KVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIV 213

  Fly   144 PALNSMGEELER---------------MHPRVYTNISRQLSRA--PFGELE---DSDMAPMLLNL 188
            ..|...|::|||               :...|:..|:.|:...  |.||.|   ....|.:::::
Human   214 ELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDV 278

  Fly   189 VAKDLFRSSITWGKIISIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIEDDLVYWLIDNGGW-- 251
            .||.....:....:::       ||.                   .:.::::...|:..:|||  
Human   279 TAKLTAIDNHPMNRVL-------GFG-------------------TKYLKENFSPWIQQHGGWEK 317

  Fly   252 -LGLS 255
             ||:|
Human   318 ILGIS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 32/186 (17%)
BCL2L14NP_001357197.1 Bcl-2_like 185..319 CDD:351812 24/159 (15%)
BH3 212..226 4/13 (31%)
BH2 308..315 2/6 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.