DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and Bcl2l14

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001342615.1 Gene:Bcl2l14 / 66813 MGIID:1914063 Length:328 Species:Mus musculus


Alignment Length:326 Identity:56/326 - (17%)
Similarity:106/326 - (32%) Gaps:126/326 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKLAKFKSSSLDHEIYTANRRGTIATASSD-WKAL----RGGVGGGAGGPGSVPNPSNGRSLHAG 68
            |||::.:|.|          :..:.|.|:| |..:    |       |.|.|..|.|.|:...:.
Mouse    45 PKLSRTRSLS----------QKALGTWSTDSWTQVSLPCR-------GSPSSEKNISLGKKKSSW 92

  Fly    69 GPMTRAA-STSSLASSTRTMT----------------NYQEYKMDIINQGKCLCGQYIRARLRRA 116
            ..:.|.| ....|.||.:.:.                :.|.:...:.:..:.|..:.:.:::  |
Mouse    93 RTLFRVAEKEEGLPSSPKEIRAQGPQGPFPVERQSGFHNQHWPRSLSSVEQRLESEVVDSKV--A 155

  Fly   117 GVLNR--------------------KVTQRLRNIL------------DPGSSHVVYEVFPALNSM 149
            .:.||                    |:.:|:..||            ..|...::.::...|...
Mouse   156 CIANRVAEIVYSWPPPDVIHSQGGSKLKERVSEILYFRFEGPCDSKNKDGEDQIISKIVELLKFS 220

  Fly   150 GEELER---MHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDL------------FRSSIT 199
            |::|.|   ....:.::....||.:.|..:.|         |..:|:            |::::.
Mouse   221 GDQLGREIKKDKALMSSFQDGLSYSTFKTITD---------LFLRDVDTRGESEVKARGFKAALA 276

  Fly   200 WGKIISIFAVCG-------GFAIDCVRQGHFDYLQCLIDGLAEIIEDDLVYWLIDNGGW---LGL 254
            ...|..:.|:..       ||....:|: :|.                  .|:..||||   ||:
Mouse   277 IDAIAKLTAIDNHPMNRMLGFGTKYLRE-YFS------------------PWVQQNGGWEKILGI 322

  Fly   255 S 255
            |
Mouse   323 S 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 33/206 (16%)
Bcl2l14NP_001342615.1 BH3 213..227 3/13 (23%)
Bcl-2_like <293..316 CDD:322001 7/41 (17%)
BH2 309..316 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.