DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and Bcl2l2

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_017455282.1 Gene:Bcl2l2 / 60434 RGDID:620717 Length:219 Species:Rattus norvegicus


Alignment Length:227 Identity:44/227 - (19%)
Similarity:81/227 - (35%) Gaps:48/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 RAASTSSLASSTRTMTNYQEYKMDIINQGKCLCGQYIRARLRRAGVLNRKVTQRLRNILDPGSSH 137
            |.|:.:|...:...:.::..||   :.|...:||         ||               ||...
  Rat    26 RMATPASTPDTRALVADFVGYK---LRQKGYVCG---------AG---------------PGEGP 63

  Fly   138 VVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLFRSSITWGK 202
            ....:..|:.:.|:|.|....|.:::::.||...|       ..|......|:.:||:....||:
  Rat    64 AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-------GSAQQRFTQVSDELFQGGPNWGR 121

  Fly   203 IISIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIEDDLVYWLIDNGGWL---------GLSRHI 258
            :::.|........:.|.:.....:..:.|.:...:|..|..|:..:|||.         .|....
  Rat   122 LVAFFVFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEAR 186

  Fly   259 RPRVGEF-----TFLGWLTLFVTISAGAYMVS 285
            |.|.|.:     ...|.:.|...::.||:..|
  Rat   187 RLREGNWASVRTVLTGAVALGALVTVGAFFAS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 28/158 (18%)
Bcl2l2XP_017455282.1 Bcl-2_like 35..173 CDD:132900 32/171 (19%)
bcl-2 37..219 CDD:273308 41/216 (19%)
ABATE 146..>205 CDD:284698 12/58 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.