DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and BCL2L2

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001186768.2 Gene:BCL2L2 / 599 HGNCID:995 Length:193 Species:Homo sapiens


Alignment Length:225 Identity:44/225 - (19%)
Similarity:81/225 - (36%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 STSSLASSTRTM-TNYQEYKMDIINQGKCLCGQYIRARLRRAGVLNRKVTQRLRNILDPGSSHVV 139
            :|.:.|..||.: .::..||   :.|...:||         ||               ||.....
Human     2 ATPASAPDTRALVADFVGYK---LRQKGYVCG---------AG---------------PGEGPAA 39

  Fly   140 YEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLFRSSITWGKII 204
            ..:..|:.:.|:|.|....|.:::::.||...|       ..|......|:.:||:....||:::
Human    40 DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-------GSAQQRFTQVSDELFQGGPNWGRLV 97

  Fly   205 SIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIEDDLVYWLIDNGGWL---------GLSRHIRP 260
            :.|........:.|.:.....:..:.:.:...:|..|..|:..:|||.         .|....|.
Human    98 AFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRL 162

  Fly   261 RVGEF-----TFLGWLTLFVTISAGAYMVS 285
            |.|.:     ...|.:.|...::.||:..|
Human   163 REGNWASVRTVLTGAVALGALVTVGAFFAS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 27/158 (17%)
BCL2L2NP_001186768.2 BH4 9..29 5/22 (23%)
bcl-2 11..193 CDD:273308 41/216 (19%)
BH1 85..104 5/18 (28%)
BH2 136..151 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.