DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and mcl1a

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_571674.1 Gene:mcl1a / 58122 ZFINID:ZDB-GENE-000511-7 Length:255 Species:Danio rerio


Alignment Length:258 Identity:50/258 - (19%)
Similarity:83/258 - (32%) Gaps:74/258 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKLAKFKSSSLDHEIYTANRRGTIATASSDWKALRGGVGGGAGGPGSVPNPSNGRSLHAGGPMTR 73
            |.|.......||.  ||......:       |.||.|..|..|             |...|....
Zfish    23 PTLKTCVEDELDG--YTEEEEAPL-------KRLRPGTNGLKG-------------LQLDGRFVS 65

  Fly    74 AASTSSLASSTRTMTNYQEYKMDIINQGKCLCGQYIRARLRRAGVLNRKVTQRLRNILDPGSSHV 138
            |...|...:......:|.|.:.|                           |::|  :||...:|.
Zfish    66 ATDGSLPTTPDPEELDYAELERD---------------------------TRQL--LLDFYRTHT 101

  Fly   139 --------VYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLFR 195
                    ::...|.:..:.:.:...|...|..:.::|      :|:....:...:..:|..:|:
Zfish   102 GMCPVDRKLHHAIPTMKRVVDNILVKHQIAYKGMIQRL------QLDSQPASLDFIRCIASTMFK 160

  Fly   196 SSIT-WGKIISIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIEDDLVY----WLIDNGGWLG 253
            ..:| ||:|.|:.|.   .|:.|.|.......|| ::.:||.|...|..    |::.|..|.|
Zfish   161 DGVTNWGRIASLVAF---GAVVCSRLKELQQDQC-VERVAEQISSYLTSEQQDWILKNKSWHG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 31/160 (19%)
mcl1aNP_571674.1 Bcl-2_like 86..223 CDD:132900 32/173 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.