DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and BAX

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001278357.1 Gene:BAX / 581 HGNCID:959 Length:221 Species:Homo sapiens


Alignment Length:206 Identity:39/206 - (18%)
Similarity:72/206 - (34%) Gaps:66/206 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NGRSLHAGGPMTRAASTSSLASSTRTMTNYQEYKMDIINQGKCLCGQYIRARLRRAG-------- 117
            :|.....|||      |||               ..|:..|..|...:|:.|..|.|        
Human     4 SGEQPRGGGP------TSS---------------EQIMKTGALLLQGFIQDRAGRMGGEAPELAL 47

  Fly   118 ------VLNRKVTQRLRNILDPGSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGEL 176
                  ...:|:::.|:.|.|...|::             ||:||...|                
Human    48 DPVPQDASTKKLSECLKRIGDELDSNM-------------ELQRMIAAV---------------- 83

  Fly   177 EDSDMAPMLLNLVAKDLFR-SSITWGKIISIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIEDD 240
             |:|....:...||.|:|. .:..||:::::|.......:..:.....:.::.::....:.:.:.
Human    84 -DTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRER 147

  Fly   241 LVYWLIDNGGW 251
            |:.|:.|.|||
Human   148 LLGWIQDQGGW 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 29/160 (18%)
BAXNP_001278357.1 bcl-2 5..182 CDD:273308 39/205 (19%)
Bcl-2_like 25..158 CDD:132900 28/162 (17%)
BH3 59..73 3/13 (23%)
BH1 98..118 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.