Sequence 1: | NP_788278.1 | Gene: | Debcl / 53585 | FlyBaseID: | FBgn0029131 | Length: | 300 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001278357.1 | Gene: | BAX / 581 | HGNCID: | 959 | Length: | 221 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 39/206 - (18%) |
---|---|---|---|
Similarity: | 72/206 - (34%) | Gaps: | 66/206 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 NGRSLHAGGPMTRAASTSSLASSTRTMTNYQEYKMDIINQGKCLCGQYIRARLRRAG-------- 117
Fly 118 ------VLNRKVTQRLRNILDPGSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGEL 176
Fly 177 EDSDMAPMLLNLVAKDLFR-SSITWGKIISIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIEDD 240
Fly 241 LVYWLIDNGGW 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Debcl | NP_788278.1 | Bcl-2_like | 107..257 | CDD:132900 | 29/160 (18%) |
BAX | NP_001278357.1 | bcl-2 | 5..182 | CDD:273308 | 39/205 (19%) |
Bcl-2_like | 25..158 | CDD:132900 | 28/162 (17%) | ||
BH3 | 59..73 | 3/13 (23%) | |||
BH1 | 98..118 | 5/19 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4728 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |