DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and bcl2a

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001025424.1 Gene:bcl2a / 570772 ZFINID:ZDB-GENE-051012-1 Length:228 Species:Danio rerio


Alignment Length:153 Identity:37/153 - (24%)
Similarity:67/153 - (43%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NQGKCLCGQYIRARLRRAGVLNRKVTQRLRNILDPGSSHVVYEVFPALNSMGEELERMHPRVYTN 163
            |..:||.     ||:.|:               ||   |:  .::..|...|:|:||::.|.:..
Zfish    64 NNSECLI-----ARVTRS---------------DP---HL--RLYRVLRDAGDEIERIYQREFEE 103

  Fly   164 ISRQLSRAPFGELEDSDMAPMLLNLVAKDLFRSSITWGKIISIFAVCGGFAIDCVRQGHFDYLQC 228
            :|:|:...|       :.|......||::|||..:.||:||:.|...|...::.|.:.....:..
Zfish   104 MSQQMVFNP-------NSAQRSFLTVAEELFRDGVNWGRIIAFFEFGGTMCVESVNREMASQVDN 161

  Fly   229 LIDGLAEIIEDDLVYWLIDNGGW 251
            :...:.:.:...|..|:.:||||
Zfish   162 IAHWMTDYLNGPLENWIEENGGW 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 34/145 (23%)
bcl2aNP_001025424.1 BH4 6..30 CDD:280361
bcl-2 9..192 CDD:273308 37/153 (24%)
Bcl-2_like 65..190 CDD:132900 36/152 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.