DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and Bok

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_058058.1 Gene:Bok / 51800 MGIID:1858494 Length:213 Species:Mus musculus


Alignment Length:156 Identity:56/156 - (35%)
Similarity:83/156 - (53%) Gaps:9/156 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DIINQGKCLCGQYIRARLRRAGVLNRKVTQRLRNILDPGSSHVVYEVFPALNSMGEELERMHPRV 160
            :::.|.|.|..:|:.|||.||| |:....:|    ..|.....:.||...|..:|:|||::.|.|
Mouse    26 ELVAQAKALGREYVHARLLRAG-LSWSAPER----ASPAPGGRLAEVCTVLLRLGDELEQIRPSV 85

  Fly   161 YTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLFRSSITWGKIISIFAVCGGFAIDCVRQGHFDY 225
            |.|::||| ..|   |:...:.......||..:|.:.|||||::|:::|..|.|:|||||.....
Mouse    86 YRNVARQL-HIP---LQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPAM 146

  Fly   226 LQCLIDGLAEIIEDDLVYWLIDNGGW 251
            :..|:|.|.|.:...|..||...|||
Mouse   147 VHALVDCLGEFVRKTLATWLRRRGGW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 53/145 (37%)
BokNP_058058.1 Interactions with ITPR1. /evidence=ECO:0000269|PubMed:23884412 15..45 7/18 (39%)
BH4 32..44 5/11 (45%)
Bcl-2_like 37..178 CDD:132900 53/145 (37%)
BH3 67..83 6/15 (40%)
Nuclear export signal. /evidence=ECO:0000250|UniProtKB:Q9UMX3 71..79 3/7 (43%)
BH1 113..132 8/18 (44%)
BH2 165..179 5/8 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834083
Domainoid 1 1.000 83 1.000 Domainoid score I8354
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I5032
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005475
OrthoInspector 1 1.000 - - otm42605
orthoMCL 1 0.900 - - OOG6_108286
Panther 1 1.100 - - LDO PTHR11256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3895
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.750

Return to query results.
Submit another query.