DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and bcl2l2

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001011065.1 Gene:bcl2l2 / 496475 XenbaseID:XB-GENE-992427 Length:188 Species:Xenopus tropicalis


Alignment Length:161 Identity:38/161 - (23%)
Similarity:62/161 - (38%) Gaps:33/161 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 ALNSMGEELERMHPRVYTNISRQLSRAP------FGELEDSDMAPMLLNLVAKDLFRSSITWGKI 203
            |:.:.|:|.|....:.::.||.|:...|      |.|             ||..||:..:.||:|
 Frog    40 AMRAAGDEFEERFRQAFSEISTQIHVTPGTAYARFAE-------------VAGSLFQGGVNWGRI 91

  Fly   204 ISIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIEDDLVYWLIDNGGWLG---------LSRHIR 259
            ::.|........:.|.:.....|..:.|.:...:|.:|..|:..||||.|         :....|
 Frog    92 VAFFVFGAALCAESVNKEMSPLLPRIQDWMVTYLETNLRDWIQSNGGWNGFLTLYGDGAIEEARR 156

  Fly   260 PRVGEFTFL-----GWLTLFVTISAGAYMVS 285
            .|.|.:..|     |.:.|...::.||...|
 Frog   157 QREGNWASLKTVLTGAVALGALMTVGALFAS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 29/126 (23%)
bcl2l2NP_001011065.1 bcl-2 1..188 CDD:273308 38/161 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.