DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and MCL1

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_068779.1 Gene:MCL1 / 4170 HGNCID:6943 Length:350 Species:Homo sapiens


Alignment Length:234 Identity:51/234 - (21%)
Similarity:93/234 - (39%) Gaps:62/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 STSSLASSTRTMTNYQEYKMDIINQGKCLCGQYIRAR---------LRRAGVLNRKVTQRLRNIL 131
            :||:..|...|....:|.:.::..|...:..:|:|.:         :.|:|..:||..:.||.: 
Human   153 NTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRV- 216

  Fly   132 DPGSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLFRS 196
                              |:.::|.|...:..:.|:|      ::::.|.... |:.|...:|..
Human   217 ------------------GDGVQRNHETAFQGMLRKL------DIKNEDDVKS-LSRVMIHVFSD 256

  Fly   197 SIT-WGKIISIFAVCGGFA---IDCVRQGHFDYLQCLIDGLAEIIEDDLVY----WLIDNGGWLG 253
            .:| ||:|:::.:. |.|.   :..:.|      :..|:.|||.|.|.||.    ||:...||.|
Human   257 GVTNWGRIVTLISF-GAFVAKHLKTINQ------ESCIEPLAESITDVLVRTKRDWLVKQRGWDG 314

  Fly   254 LSR--HIRPRVGE-----FTFLGWLTLFVTISAG-AYMV 284
            ...  |:....|.     ..|.|    ...:.|| ||::
Human   315 FVEFFHVEDLEGGIRNVLLAFAG----VAGVGAGLAYLI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 37/168 (22%)
MCL1NP_068779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..87
PEST-like 104..175 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 148..171 5/17 (29%)
Bcl-2_like 175..318 CDD:132900 38/175 (22%)
BH3 209..223 3/32 (9%)
BH1 252..272 5/20 (25%)
BH2 304..319 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.