DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and bokb

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_957479.1 Gene:bokb / 394160 ZFINID:ZDB-GENE-040426-1346 Length:211 Species:Danio rerio


Alignment Length:180 Identity:63/180 - (35%)
Similarity:97/180 - (53%) Gaps:9/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ASTSSLASSTRTMTNYQEYKMDIINQGKCLCGQYIRARLRRAGVLNRKVTQRLRNILDPGSSHVV 139
            |.:|.||:....:.:....:.:::.|.|.||..:|.:|:.|.|:...||...|     |....|:
Zfish     5 ARSSVLAAEMIDVFDRTHTEKELVFQSKELCRDFIHSRITREGLSWSKVELDL-----PEPRGVL 64

  Fly   140 YEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLFRSSITWGKII 204
            .:|...|..:|:|||.|.|.||.||::||:.:...|...||   ..|: ||.::....|||||::
Zfish    65 VDVSVVLLKLGDELECMRPYVYRNIAKQLNISVSVEAVVSD---AFLS-VATEVIAMGITWGKVV 125

  Fly   205 SIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIEDDLVYWLIDNGGWLGL 254
            :|:||..|.|:||||.||...:..::|.|.|.:...||.||...|||:.:
Zfish   126 AIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRRSLVPWLKKRGGWVDI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 55/148 (37%)
bokbNP_957479.1 Bcl-2_like 29..178 CDD:132900 59/156 (38%)
BH4 32..44 5/11 (45%)
BH3 67..83 7/15 (47%)
BH1 113..132 8/18 (44%)
BH2 165..179 5/11 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576779
Domainoid 1 1.000 90 1.000 Domainoid score I7754
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4946
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1278637at2759
OrthoFinder 1 1.000 - - FOG0005475
OrthoInspector 1 1.000 - - mtm6365
orthoMCL 1 0.900 - - OOG6_108286
Panther 1 1.100 - - O PTHR11256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3895
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.