DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and bcl2l10

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_919379.1 Gene:bcl2l10 / 373113 ZFINID:ZDB-GENE-030825-2 Length:176 Species:Danio rerio


Alignment Length:113 Identity:26/113 - (23%)
Similarity:61/113 - (53%) Gaps:6/113 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 ALNSMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLFRSSITWGKIISIFAV 209
            |:..:.:|:|:.|...:.::|::     |.:...:|.:..|.:::.:.:....:.||:::|||..
Zfish    34 AMRYLAKEMEQQHRTKFRSLSQE-----FLDTCGADPSKCLQSVMRELVGDGKMNWGRVVSIFTF 93

  Fly   210 CGGFAIDCVRQG-HFDYLQCLIDGLAEIIEDDLVYWLIDNGGWLGLSR 256
            .|..|.:.:.:| :.:..:.|.:.:|:.:..:...||::||||.|..|
Zfish    94 TGVLASELLSRGENSEGSRRLAETIADYLGGEKQDWLVENGGWEGFCR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 26/113 (23%)
bcl2l10NP_919379.1 Bcl-2_like 6..142 CDD:132900 26/113 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.