DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and Bcl2

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_058689.2 Gene:Bcl2 / 24224 RGDID:2199 Length:236 Species:Rattus norvegicus


Alignment Length:176 Identity:46/176 - (26%)
Similarity:71/176 - (40%) Gaps:27/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 TQRLRNIL---DPGSSHVVYEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPML 185
            |..||.::   .|..|.|...|...|...|::..|.:.|.:..:|.||...||       .|...
  Rat    69 TSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPF-------TARGR 126

  Fly   186 LNLVAKDLFRSSITWGKIISIFAVCGGFAIDCVRQGHFDYLQCLIDGLA----EIIEDDLVYWLI 246
            ...|.::|||..:.||:|::.|...|...::.|.:    .:..|:|.:|    |.:...|..|:.
  Rat   127 FATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNR----EMSPLVDNIALWMTEYLNRHLHTWIQ 187

  Fly   247 DNGGWLGLSRHIRPRVGEFTFLGWLTLFVTIS---------AGAYM 283
            |||||........|.:.......||:|...:|         .|||:
  Rat   188 DNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 38/139 (27%)
Bcl2NP_058689.2 BH4 10..30
bcl-2 11..236 CDD:273308 46/176 (26%)
BH3 90..104 3/13 (23%)
BH1 133..152 7/18 (39%)
BH2 184..199 6/14 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.