Sequence 1: | NP_788278.1 | Gene: | Debcl / 53585 | FlyBaseID: | FBgn0029131 | Length: | 300 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_031563.1 | Gene: | Bcl2l2 / 12050 | MGIID: | 108052 | Length: | 193 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 38/198 - (19%) |
---|---|---|---|
Similarity: | 73/198 - (36%) | Gaps: | 30/198 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 KCLCGQYIRARLRRAGVLNRKVTQRLRNILDPGSSHVVYEVFPALNSMGEELERMHPRVYTNISR 166
Fly 167 QLSRAPFGELEDSDMAPMLLNLVAKDLFRSSITWGKIISIFAVCGGFAIDCVRQGHFDYLQCLID 231
Fly 232 GLAEIIEDDLVYWLIDNGGWL---------GLSRHIRPRVGEF-----TFLGWLTLFVTISAGAY 282
Fly 283 MVS 285 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Debcl | NP_788278.1 | Bcl-2_like | 107..257 | CDD:132900 | 29/158 (18%) |
Bcl2l2 | NP_031563.1 | BH4 | 9..29 | 4/17 (24%) | |
bcl-2 | 11..193 | CDD:273308 | 38/198 (19%) | ||
BH1 | 85..104 | 5/18 (28%) | |||
BH2 | 136..151 | 4/14 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4728 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |