DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and Bcl2l10

DIOPT Version :9

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_038507.1 Gene:Bcl2l10 / 12049 MGIID:1330841 Length:191 Species:Mus musculus


Alignment Length:131 Identity:28/131 - (21%)
Similarity:52/131 - (39%) Gaps:30/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LNSMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLFRSSITWGKIISIFAVC 210
            |.|:..::::.|...:::...  ||....||    :..|...|::||   ...:|.:::.:.|  
Mouse    42 LRSVTRQIQQEHQEFFSSFCE--SRGNRLEL----VKQMADKLLSKD---QDFSWSQLVMLLA-- 95

  Fly   211 GGFAIDCVRQGHFDYLQCLID-GLAEIIEDD------LVYWLIDN----------GGWLGLSRHI 258
              ||...:.||.:..::...| |...|:..|      .:|.|:..          |||.|..|..
Mouse    96 --FAGTLMNQGPYMAVKQKRDLGNRVIVTRDCCLIVNFLYNLLMGRRHRARLEALGGWDGFCRFF 158

  Fly   259 R 259
            :
Mouse   159 K 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 27/127 (21%)
Bcl2l10NP_038507.1 BCL 42..151 CDD:214626 24/121 (20%)
BH1 79..98 5/25 (20%)
BH2 144..155 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4728
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.