DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and Bcl2a1d

DIOPT Version :10

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_031562.1 Gene:Bcl2a1d / 12047 MGIID:1278325 Length:172 Species:Mus musculus


Alignment Length:171 Identity:42/171 - (24%)
Similarity:72/171 - (42%) Gaps:39/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PALNSMGEELERMHPRVYTNISRQLSRAPFGELED-----SDMAPMLLNLVAKDLFRSS-ITWGK 202
            ||..|...:..|:..||..::.:::.:.....|:|     .|.|.::.|.|.:..|... |.||:
Mouse    24 PAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGR 88

  Fly   203 IISIFAVCGGFAIDCVRQ-------GHFDYLQCLIDGLAEIIEDDLVYWLIDNGGWL-GLSRHIR 259
            |::|||. ||..:..:.|       |.:..:...:   ||.|.::...|:..||||. |..:...
Mouse    89 IVTIFAF-GGVLLKKLPQEQIALDVGAYKQVSSFV---AEFIMNNTGEWIRRNGGWEDGFIKKFE 149

  Fly   260 PRVGEFTFLGWLTLFVTISAGAYMVSNVCRRIGGQLYSLLF 300
            |:.|..|||                     ::.||::.:||
Mouse   150 PKSGWLTFL---------------------QMTGQIWEMLF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 33/126 (26%)
Bcl2a1dNP_031562.1 BCL 37..140 CDD:214626 26/106 (25%)

Return to query results.
Submit another query.