DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Debcl and Bcl2a1c

DIOPT Version :10

Sequence 1:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_031561.2 Gene:Bcl2a1c / 12046 MGIID:1278327 Length:128 Species:Mus musculus


Alignment Length:87 Identity:23/87 - (26%)
Similarity:40/87 - (45%) Gaps:14/87 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PALNSMGEELERMHPRVYTNISRQLSRAPFGELED-----SDMAPMLLNLVAKDLFRSS-ITWGK 202
            ||..|...:..|:..||..::.:::.:.....|:|     .|...::.|.|.:..|.:. |.||:
Mouse    24 PAFESAPSQAFRVLQRVAFSVQKEVGKNLKSYLDDFHVESIDTTRIIFNQVMEKEFENGIINWGR 88

  Fly   203 IISIFAVCGGFAI-------DC 217
            |::|||. ||..:       ||
Mouse    89 IVTIFAF-GGVLLKKTSTRADC 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 23/87 (26%)
Bcl2a1cNP_031561.2 Bcl-2 37..>102 CDD:459816 17/65 (26%)

Return to query results.
Submit another query.